KEGG   Odoribacter splanchnicus: Odosp_0251Help
Entry
Odosp_0251        CDS       T01428                                 

Definition
Glycoside hydrolase, family 20, catalytic core
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
osp  Odoribacter splanchnicus
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osp00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Odosp_0251
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Odosp_0251
Enzymes [BR:osp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Odosp_0251
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
289472..291490
Genome map
AA seq 672 aa AA seqDB search
MNMMKQKTNFAGLVKRVTCLICGICFCFGIYAQQQKPFVIPELKEWKGATGFFMPKQSVR
IIYGAPGLQKIARQFAADYKALFGVLPEIAEGKPCKGDFFFTIKRDKKLEKEGYDIVIGD
YVKVSANEPVGVYWATRTLLQMGEQYKNGNLPKGHIRDWPDYGIRGLLIDCGRKFIPMNY
LRDLACIMSYYKMNFMHVVLNNNGFKAYFNDDWNQTYAAFRLECETYPGLTARDGYYTKK
EFVHFQEEAAERFVEIIPEIDIPAHSLAFSHYKPELGSKEYGMDHLNLSHPEVYSFVDAL
FKEYLDGENPVFRGPRVHIGTDEYSNKKKEVVEQFRAFTDHYIKFVEGFGKQACVWGALT
HAAGETPVKSDNVIMYAWYNGFANPKDMVQQGYNLISIPDGLTYIVPLAGYYWDYLNTER
LYKQWTPAHVADVVFEEKDPAIIGGMFAVWNDIVGNGISVKDIHHRIFPALQTIAVKTWN
IAPAFSYTEFETKRQKLSEAPDVNQLGRIGDDENSLVYETSSITPGSELPYTEIGYDYTI
TFDMEAANENYGTELFRSPNAVFYLADPVKGMFGFSRDGYMNTFAFRPYPGEKISVKITG
DALSTSLFINGQLIERMGIEKRYLNEAEKQNNFIRTLVFPLKNAGNFKSKITNLKVYNRL
CSHGTRAKTDRH
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgatgaaacaaaaaacaaattttgccggattagtaaaacgagtgacctgctta
atttgcgggatctgtttttgtttcggtatctatgctcagcaacagaaaccctttgtgata
cctgaactgaaggagtggaaaggagcaacaggcttctttatgccaaagcagtctgtgcgc
atcatttatggtgctcctgggttgcagaagattgcccgacaatttgctgccgactataag
gcattgttcggagtacttccggaaatcgccgagggaaagccttgtaaaggcgattttttc
ttcacaataaagcgagataaaaagttggagaaagaggggtatgacattgttatcggtgat
tatgtaaaagtttctgcgaatgaacctgtcggagtgtattgggctacccgcactttattg
cagatgggcgaacaatacaagaacggaaacttgccgaaaggacatatccgggactggccg
gattacggtatacgcggactattgatagactgcgggcgaaagtttattcctatgaattat
ctacgtgaccttgcgtgtataatgtcatattacaaaatgaacttcatgcatgtggtattg
aacaacaacggtttcaaagcctatttcaatgacgattggaatcagacctatgcagccttc
agactggaatgtgaaacatatcccggactgacagcccgcgatggttactatactaaaaaa
gaattcgtccattttcaggaggaagccgcagaacgttttgtcgagatcattcccgaaatc
gacattcctgcccattcgcttgccttcagtcattacaaaccggaattaggcagcaaggaa
tatggcatggatcatttgaatttgtctcatcccgaagtctattcatttgttgatgcactc
ttcaaagaatatcttgatggagagaaccctgtattccggggacctagagtgcatattggc
accgacgaatattcaaataaaaagaaagaagttgtggaacagttccgggcattcaccgat
cattacattaaattcgtagaaggttttggaaaacaagcatgtgtatggggagcactcaca
catgccgcaggagaaacacctgttaaatcagataatgtcattatgtatgcttggtacaat
ggttttgccaatccgaaagatatggtgcaacaaggatataatttgattagtattccggat
ggtctgacttacatcgtaccgcttgcaggttattattgggactatctgaacacagaacgg
ttgtataagcaatggactccggcacatgtagccgatgttgtatttgaggagaaagatccg
gcaattattggcggtatgtttgctgtatggaatgacatagttggtaacgggatttctgtg
aaagacatccatcaccgtattttcccggctttgcagactattgcggtgaaaacatggaac
attgctcctgcattttcttatacagaatttgaaacaaaacggcaaaaactgagtgaggct
ccggatgtgaatcaattgggcaggatcggtgatgatgaaaacagtcttgtgtatgagact
tcatcaattactcccggatccgagttgccgtataccgaaatcggatatgactatacaatc
acgtttgatatggaagctgccaatgaaaattatggcaccgaattatttcgttcccctaat
gctgtattttatcttgccgatcctgtgaaaggtatgttcggcttctcccgggatggctat
atgaacacttttgctttccggccttatccgggagaaaagatttctgtaaaaatcacaggg
gatgctctctccacttcattgttcataaacggacaacttatcgaacgaatgggaattgaa
aaacgatatctgaacgaagccgaaaagcagaataattttatccgtacattagtatttccg
cttaaaaatgccggaaatttcaaatctaagattactaatctgaaagtgtataatcggtta
tgttcccatggaaccagggcgaagacggaccgacactga

DBGET integrated database retrieval system