KEGG   Odoribacter splanchnicus: Odosp_0292Help
Entry
Odosp_0292        CDS       T01428                                 

Definition
1,4-alpha-glucan branching enzyme (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
osp  Odoribacter splanchnicus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Odosp_0292
Enzymes [BR:osp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Odosp_0292
Exosome [BR:osp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Odosp_0292
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
337764..339770
Genome map
AA seq 668 aa AA seqDB search
MKFDITVNDPLLEPFLPVIRRRHERSVLKELEFTNRKKKLADIFNNHLYFGLHRLPGKGW
VFREWAPHATAIYLIGESNDWQRRENFSFHRLEGGVWELELPEEALWHGMDYKFWVEWPE
GGGERIPGYVNRVVQDDLTKIFSAQVWQPEQVYRWRYSGVGRREHPLIYEAHIGMSMENR
RVSTFNEFRAYVLPRIVDLGYNMIQLMGIQEHPYYGSFGYQVSNFYAVSSRFGTPDDLKR
LIDEAHGYGIGVIMDLVHSHAVKNEAEGLSCFAGDYNQYFYPGERGEHRLWNSRCFDYGK
NEVIGFLLSNCKYWLEEFHFDGFRFDGITSMLYWDHGLGRDFTEYKFYYDGNQDEDAITY
LTLANKLIHEVNPEVITIAEDMSGMPGLAMPVGEGGLGFDFRMSMGVPDYWIKLIEDKKD
EEWHVGDMFYELTNKRPEEHTISYAESHDQAMVGDKTIFFRLVDKDIYTSMSVFDHSLRV
DRGMALHKMIRLMTIATAGDGYLNFMGNEFGHPEWIDFPREGNNWSYEHARRLWSLVDDK
DLRFRFLNEFDKAMISLAKKDGFFKPIPLPVVRDNERQILVFRRGAYLFVFNFNPQSSFS
DYRFEVEAGKYLPVLDTDNQLFSGFNRIDDGLEHFTLYREGRNWLSLYIPSRTAVVLQLQ
EENLKMKK
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttgatatcacagtcaacgatcctttgctggaaccttttcttcctgttatccgg
cgtcgccatgaacgcagtgtgctgaaagagctggaatttaccaaccggaaaaagaaactc
gccgatatttttaataatcatctttattttggtttgcaccggcttcctggaaaaggttgg
gtattccgggaatgggctcctcatgctacggcgatttatctgatcggagaatcgaatgac
tggcaacgaagggagaattttagcttccaccggctggagggaggggtttgggaattggaa
ttacccgaagaagccctctggcatgggatggattacaagttctgggtagagtggcccgaa
ggaggaggtgaacggattcccgggtatgtaaaccgggttgtacaggacgatctgactaaa
attttttcagcgcaggtctggcaacccgaacaagtttaccggtggcgttattccggtgta
ggaagaagggagcatcctttgatttacgaagctcatatcggtatgagcatggagaatcgc
cgggtgtctacgtttaatgaattccgggcttatgtattgccccggattgtagatttgggg
tacaatatgattcagctgatggggattcaggaacatccctattatggttctttcggctat
caggtatcgaatttttatgcggtcagttcccgattcggaacacccgacgacctgaaacgt
ctgatcgatgaggcacatggatacggtatcggtgtgatcatggatcttgtgcattctcat
gcagtcaagaatgaagccgaaggattgagttgttttgccggagattataaccagtatttt
tatcctggtgaacggggtgaacatcgattgtggaattcccgttgcttcgattatggaaaa
aatgaagtgatcggttttttgttgtcgaattgtaaatattggctggaagaatttcatttc
gatggcttccgtttcgatgggatcaccagtatgctgtattgggatcatggtttagggcgt
gattttacggaatacaaattttattacgacggtaatcaggatgaagatgcgattacctat
ctgactttagccaataagttgatccatgaggtgaatccggaagtgatcacgattgccgaa
gatatgagcggtatgccgggtttagcgatgcctgtcggcgagggaggattaggtttcgat
tttcgtatgagcatgggagtaccggattattggatcaaattgatcgaagataaaaaagat
gaggagtggcatgtcggggatatgttttacgaactgaccaacaaacgtccggaagagcat
accatcagttatgccgaaagtcacgatcaggctatggtaggggataaaaccatctttttc
cgtttggtcgacaaggatatctatacttcgatgagtgttttcgaccatagccttcgggtc
gaccggggcatggcacttcataaaatgatccggctgatgacgatagccactgccggcgac
ggatacctgaattttatggggaatgaattcggccatcccgaatggatcgattttccccgg
gaaggaaataattggagctacgaacatgcccgccggctgtggagtctggtagacgacaag
gatttgcgtttccgttttctgaacgaattcgataaagcgatgatttctttagcaaagaaa
gacggcttttttaaacctatcccactgcctgtcgtaagagataatgagagacagatattg
gttttccggagaggcgcttatctgtttgtttttaattttaatccccaaagttcattctcc
gactatcggttcgaggtggaagcgggaaaatatttgccggtattggataccgacaatcag
ttgttctccggttttaaccggatcgatgacgggctggaacattttaccctttaccgggaa
ggacgaaactggttgagtctctatattccttcccgtacggctgttgtcctgcaattgcag
gaggaaaaccttaaaatgaaaaaataa

DBGET integrated database retrieval system