KEGG   Odoribacter splanchnicus: Odosp_0296Help
Entry
Odosp_0296        CDS       T01428                                 

Definition
alpha-glucan phosphorylase (EC:2.4.1.11 2.4.1.1)
Orthology
K16153  
phosphorylase / glycogen(starch) synthase [EC:2.4.1.1 2.4.1.11]
Organism
osp  Odoribacter splanchnicus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Odosp_0296
Enzymes [BR:osp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     Odosp_0296
    2.4.1.11  glycogen(starch) synthase
     Odosp_0296
Glycosyltransferases [BR:osp01003]
 Polysaccharide
  Storage polysaccharide
   Odosp_0296
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
344790..349073
Genome map
AA seq 1427 aa AA seqDB search
MYLRGSFNTRKSNMDNNKLKNPAYLFEVSWEVCNKVGGIHTVISTKALNMEKEYSSSHIL
IGPDVWRYTEQNPEFIDDPRLFRSWRQRAAQEGLRIKVGRWNVAGKPIVILVDFSTFITQ
KDEIFASFWEKYKLDSISGQWDYIEPALFGYAAGKVIESFVRFNSSIRQRIIAQFHEWMT
GAGLLYLKSAMPQVGCVFTTHATVLGRCVAGNNLPLYSEMKNYVPEELARRFNVISKQSL
EKTAAHQADCFTTVSEITATECAHFLDKEVDLVTPNGFENVFTPSEAEWEDKRKAGREKF
LQVAQAILGRPVAEDALILGISGRYEFKNKGIDVFIDAMGQLNRNNGLGKEVLAFILVPA
GHAGANKELLHNLELPYQAVTSTDLYLTHYLNDSANDPVMNRIRAQKLRNSEEDKVKIFF
VPSYLNGDDGVFNMPYYDLLVGMDLTAFPSYYEPWGYTPLESLAFKVPTITTTLAGFGLW
VKEHYNMNHPGIEVIHREDGDASNVATAIAEWVKNYTQVGETEMQKDRDNAKDVSRIALW
DNLINYYKQAYTIALNQVSERLKDLPANMNESVSYIEKQLTVNNPSWVSVMIHRSIPEKL
IALEELSKNLWWAWNEGARELFRMIDVDKWRACGHNPIMLLDSISLARYKELENDAGFVH
KLEEVYAQFKAYMAAKEHMSGNGVAYFSMEYGLHTSLKIYSGGLGILAGDYLKEASDKGT
KITAVGLLYRYGYFTQKLSAMGDQEAEYEAQDFMKIAVTPVRDKEGNWETISLVFPGRNV
YARIWRVDVGRIELYLLDTDFEDNLPEDRSITHHLYGGDWENRLKQELLLGCGGIQALRK
LGIEASTYHCNEGHAAFTGLERLKEYITEERLTFAEAIEVVRASSLFTTHTPVPAGHDAF
SENMLRTYISHYADRLKISWEQLLGLGKINVADPNEKFSMSFLAANLAQEMNGVSWLHGE
VSKEIFKGMWPGYMAEELHISYVTNGVHYPTWAAPEWKKIEESLFGEDFKNHHYDKKCFE
QIYTVPDAVVYEVRTKLRKRLIDHVKELLKDEVAASYFTPRQVIQIRETLRDDILTIGFA
RRFATYKRAHLLFRNLERLDEIVNNPKHPVQFIFAGKAHPADKAGQDLIKRIVEVSKYPQ
FLGKIIFLPNYDMDLAKKLVQGVDVWMNTPTRPQEASGTSGEKAAMNGVMHFSVLDGWWV
EGYRKDAGWMLPMERTFENQAMQDELDSEMIYNIIDDEIAPLFYERDANGLSPKWISYIK
NTIARVASNFTTNRMLEDYEKQYYVPMSARYQKMIENDFAMAAEIAEWKKKISREWDNIE
LVGLDLPNRSKQIIALGKSYYGEVKLEIGELSMHEVGVELVAAEQKDGRQVIREKHDFIP
VEQVGSVARYRIDVTADSPGLLMLAIRIYPKSELLPHRQDFALVKWL
NT seq 4284 nt NT seq  +upstreamnt  +downstreamnt
atgtaccttcggggctcatttaacacacgcaaaagtaatatggataacaataaattgaag
aatcccgcttacctttttgaagtaagttgggaagtttgtaataaagtggggggaattcat
acggtgatttcgaccaaagccctcaatatggaaaaagaatacagcagtagtcatatttta
atcggccccgatgtctggcgttataccgaacagaatcctgaatttatcgacgatccccgt
ttgttcaggtcctggcggcagagagcagcccaggaaggcttgcgtattaaagtaggacgg
tggaatgtggctggaaaaccgattgtcatcctggttgatttcagtacgttcattacgcag
aaagatgaaatttttgcttctttttgggaaaaatataaactcgattcgattagtggtcaa
tgggattacatcgaaccggccctgttcggatatgcagcagggaaagtgatcgagagcttc
gttcgctttaattcttctatccggcagcggattatcgcccaatttcacgaatggatgacg
ggagccggattattgtatttgaaaagtgcgatgcctcaggtgggatgtgtatttaccact
catgccaccgtgttgggccgttgtgtagccgggaataatctacccctgtacagtgagatg
aaaaattatgtacccgaagaactggcacgtcgtttcaatgtcatttccaaacagtctctc
gagaagaccgcagcacatcaagccgattgtttcactacggtcagtgagatcacggctacc
gaatgtgctcattttctggataaagaagtagacctggttactcccaatggatttgagaat
gtctttacgccttccgaagccgaatgggaagacaaacgaaaggccggaagagaaaaattt
cttcaggtggcacaggcgattttggggcgtcccgtagccgaagacgccttgatcctgggt
atcagtggacggtacgagtttaaaaacaaaggaatcgatgtctttatcgatgccatggga
caattgaatcgtaacaacggactcggtaaagaggtgttggcctttattttggtacctgcc
ggacatgccggtgcaaacaaggaattgctgcataacctggaattaccttatcaggccgtt
acctctacagatctttatctgacacattatctcaacgatagtgccaacgatccggtgatg
aaccgtatccgggcacaaaaattgcgtaattccgaggaagataaagtgaagatcttcttc
gttcccagttatctgaatggagatgacggggtattcaatatgccttactatgatttgctg
gtggggatggatctgaccgctttcccgtcttattacgagccttggggatatactccgctc
gaaagtctggcgtttaaagtgcctaccattacgaccactttggccggattcggactgtgg
gtgaaagaacattataatatgaatcatcccggtatagaagttattcaccgcgaagacggt
gatgcgtccaatgtggctacggctatcgccgaatgggtaaaaaattatacacaggtcgga
gaaactgaaatgcagaaagaccgggacaatgccaaagatgtttcccggattgcactttgg
gataatctgatcaattattataaacaggcttatacgatcgctttgaaccaggtcagcgaa
cgcttgaaagacctgcctgccaatatgaacgaatcggtatcttatatcgaaaaacagctc
acggtaaataatcccagctgggtcagtgtgatgatccatcgctctattcccgaaaaactg
atcgctctggaagaattatccaaaaacctttggtgggcctggaatgaaggtgctcgtgaa
ttattccggatgatcgatgtcgataaatggagggcttgcggtcacaatccgatcatgttg
ttggattcgatttccctggctcgttataaagaactggaaaatgatgccggtttcgtgcat
aaacttgaagaagtatatgctcagtttaaagcctatatggcagcgaaagaacatatgtcc
gggaatggggttgcttacttcagtatggagtatggtttgcatacttcgttgaagatctat
tccggaggattgggaatcctggccggtgactacctgaaagaggccagcgataaagggacg
aagattacggctgtcggtttattgtatcgttatggttatttcacacagaaattatctgct
atgggtgatcaggaagccgaatacgaagctcaggattttatgaagatcgccgtaaccccg
gtacgtgacaaggaaggtaattgggaaaccatcagtctggtattcccgggacggaatgta
tatgcccggatctggagggtcgatgtcggccggatagagctctatctgctggataccgat
ttcgaagataacttgcccgaagaccggagtatcacccaccatctgtatggcggagattgg
gaaaaccgcttgaaacaggaacttttgctcgggtgtggaggtattcaggccttgcgaaaa
ctgggtatcgaagcttctacttaccattgcaatgagggacatgctgctttcaccgggctg
gaaagattgaaagaatatattaccgaggaacgcctgacttttgccgaagcgatcgaagtg
gtgcgggcatcttctttgtttacgactcatacacctgtacctgcaggacatgatgccttt
tcggaaaatatgctgcgtacttacatctctcattatgccgatcggctgaaaatctcctgg
gaacagctgttgggattaggaaaaatcaatgtcgccgatccgaatgagaaattctctatg
agcttccttgcggctaatctggctcaggaaatgaatggggttagctggttgcacggcgaa
gtgagtaaagagattttcaaaggcatgtggccgggatatatggccgaggagttgcacatc
agttatgtgaccaacggggtacattatccgacttgggcggctcccgaatggaagaaaata
gaagaatctttgttcggtgaagattttaagaatcatcattacgataagaaatgtttcgaa
caaatctataccgttcccgatgctgtcgtatatgaggtgcgtaccaaattgcgtaagcgc
ctgatcgatcatgtaaaagaattgctgaaagacgaggtggctgcctcttatttcactccc
cggcaggtgattcagatccgtgaaactttgcgggacgatattctgaccataggttttgcc
cggcgtttcgctacctacaagagggctcacctgttgttccgtaacctcgaacgcctggat
gaaatcgtcaataaccccaaacatccggtgcagtttatctttgccgggaaagcccatcct
gccgataaagccggacaggacctgatcaaacggattgtcgaggtatccaaatatccgcaa
ttcctgggtaagatcatctttctgcctaactatgatatggatctggccaagaaattggta
caaggggttgatgtctggatgaatacgccgacccggcctcaggaagcttcgggtaccagt
ggcgaaaaggctgctatgaacggtgttatgcatttctccgtgctcgacggctggtgggtc
gaaggatatcgtaaagatgccggatggatgctgccgatggaaagaactttcgaaaatcag
gccatgcaggatgaattggattctgaaatgatatataacattatcgacgatgagatcgct
cctctgttctacgaacgggatgctaacggattatcacctaaatggatcagctatatcaaa
aatactattgccagggtggcttcgaattttacgaccaaccggatgctggaagattatgaa
aaacaatattatgttccgatgtctgcccgctatcagaagatgatcgaaaatgatttcgcc
atggcggcagaaattgccgaatggaaaaagaaaatttcccgcgaatgggataatatcgag
ttagtcggattggacctgcccaatcgttccaaacagatcatcgctttggggaaatcttat
tacggagaggtgaaactcgagatcggcgaactcagtatgcatgaagtgggagttgaattg
gtggctgccgaacagaaagacggacgccaggttatccgcgaaaaacacgattttatccct
gttgaacaagtgggtagtgtggccagataccgcatcgatgtgactgccgactctccggga
ttgctgatgctggccatccgtatctacccgaaaagcgaattactgccccatcgccaggac
tttgctttggtaaaatggctgtaa

DBGET integrated database retrieval system