KEGG   Odoribacter splanchnicus: Odosp_0397Help
Entry
Odosp_0397        CDS       T01428                                 

Definition
phospholipase A1
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
osp  Odoribacter splanchnicus
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osp00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Odosp_0397
   00565 Ether lipid metabolism
    Odosp_0397
   00590 Arachidonic acid metabolism
    Odosp_0397
   00591 Linoleic acid metabolism
    Odosp_0397
   00592 alpha-Linolenic acid metabolism
    Odosp_0397
Enzymes [BR:osp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     Odosp_0397
    3.1.1.32  phospholipase A1
     Odosp_0397
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
472659..473501
Genome map
AA seq 280 aa AA seqDB search
MTFKIVVLSLMLGIWGLDAWSQNEEPDFSGQSEDSLMQALGNIPAFTIYKDNYVVTGTSF
TGGKISKYNSDAKFQISLRHRLYRKLLPYRIYLFLTYSQKSFWDIYRKSAPFADNNYNPS
LGFGRNFIGEGRIKGIGMVQFEHESNGRDSIWSRSWNRLTFTGIYLMNKNYTFQAKVWIA
MQVAKENRHLTRYAGIGHLAATYASDNGRLSCSALMIKRGGWNWNANWRLEVAYRLFRED
NQYLFMQFCNGYGESMIAYNQFRRYLRFGFVIKPRSVTIF
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgacttttaaaattgttgttttgagtttgatgttaggtatttggggcttggatgcctgg
tcacaaaatgaagagccggacttttcgggacaatcggaagatagtctgatgcaggcttta
ggaaatataccggctttcactatatataaagataattatgtggtgaccggaacgagtttc
accggtggaaaaatttcgaaatacaattcggatgctaaatttcagattagcttacgccac
cggctttaccgtaagttattgccttatcggatttatttattcctgacgtatagccagaag
tctttttgggatatttaccggaaatcggccccttttgcggacaataattataacccttct
ttagggttcggacgtaattttatcggggagggaaggattaaaggtatcgggatggtgcag
ttcgagcatgaatcgaacgggcgcgacagtatttggtcgaggagttggaaccggttgact
tttaccggtatttatctgatgaataaaaattatacttttcaggccaaggtttggatagct
atgcaggtagctaaagaaaacagacacctgaccagatatgccggaatcggacatttggca
gcgacttatgccagtgataacggacgtttgtcctgttcggccttaatgataaaacggggt
gggtggaattggaatgcgaattggcgtttggaggttgcctatcgattgttcagagaagat
aaccagtatttatttatgcaattttgtaatggatatggcgaaagtatgatcgcctacaat
cagttcaggcgttacttacggtttggatttgtgatcaaaccccgctcggtgactatattt
taa

DBGET integrated database retrieval system