KEGG   Odoribacter splanchnicus: Odosp_0397Help
Entry
Odosp_0397        CDS       T01428                                 

Definition
phospholipase A1
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
osp  Odoribacter splanchnicus
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:osp00564]
Metabolism; Lipid metabolism; Ether lipid metabolism [PATH:osp00565]
Metabolism; Lipid metabolism; Arachidonic acid metabolism
Metabolism; Lipid metabolism; Linoleic acid metabolism
Metabolism; Lipid metabolism; alpha-Linolenic acid metabolism [PATH:osp00592]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
472659..473501
Genome map
AA seq 280 aa AA seqDB search
MTFKIVVLSLMLGIWGLDAWSQNEEPDFSGQSEDSLMQALGNIPAFTIYKDNYVVTGTSF
TGGKISKYNSDAKFQISLRHRLYRKLLPYRIYLFLTYSQKSFWDIYRKSAPFADNNYNPS
LGFGRNFIGEGRIKGIGMVQFEHESNGRDSIWSRSWNRLTFTGIYLMNKNYTFQAKVWIA
MQVAKENRHLTRYAGIGHLAATYASDNGRLSCSALMIKRGGWNWNANWRLEVAYRLFRED
NQYLFMQFCNGYGESMIAYNQFRRYLRFGFVIKPRSVTIF
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgacttttaaaattgttgttttgagtttgatgttaggtatttggggcttggatgcctgg
tcacaaaatgaagagccggacttttcgggacaatcggaagatagtctgatgcaggcttta
ggaaatataccggctttcactatatataaagataattatgtggtgaccggaacgagtttc
accggtggaaaaatttcgaaatacaattcggatgctaaatttcagattagcttacgccac
cggctttaccgtaagttattgccttatcggatttatttattcctgacgtatagccagaag
tctttttgggatatttaccggaaatcggccccttttgcggacaataattataacccttct
ttagggttcggacgtaattttatcggggagggaaggattaaaggtatcgggatggtgcag
ttcgagcatgaatcgaacgggcgcgacagtatttggtcgaggagttggaaccggttgact
tttaccggtatttatctgatgaataaaaattatacttttcaggccaaggtttggatagct
atgcaggtagctaaagaaaacagacacctgaccagatatgccggaatcggacatttggca
gcgacttatgccagtgataacggacgtttgtcctgttcggccttaatgataaaacggggt
gggtggaattggaatgcgaattggcgtttggaggttgcctatcgattgttcagagaagat
aaccagtatttatttatgcaattttgtaatggatatggcgaaagtatgatcgcctacaat
cagttcaggcgttacttacggtttggatttgtgatcaaaccccgctcggtgactatattt
taa

DBGET integrated database retrieval system