KEGG   Odoribacter splanchnicus: Odosp_0590Help
Entry
Odosp_0590        CDS       T01428                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritolkinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
osp  Odoribacter splanchnicus
Pathway
osp00900  Terpenoid backbone biosynthesis
osp01100  Metabolic pathways
osp01110  Biosynthesis of secondary metabolites
osp01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:osp00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Odosp_0590
Enzymes [BR:osp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Odosp_0590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: ADY31673
UniProt: F9Z6N6
Position
697640..698464
Genome map
AA seq 274 aa AA seqDB search
MVVFPHAKINIGLFVTGKRNDGFHNLETIFFPVGWSDILEIGRGEGESGSFRFKNTGLEV
GGDPGKNLVIKAYHLLAADFHLPAIQVHLHKIIPFGAGLGGGSADAAFMLKALNAFFDLR
LSGQKMVTYAARLGSDCAFFIDDRPAFASGKGELLEPIELTLAGYRIIIVKPSFGVSTPE
AYAGITPRPAGYDLRQLGQLPVNTWKEYIRNDFEATVFQKYPSLTLLKQQLYERGAEFVS
MSGSGSAIYGLFKKDREINLDFPDCCVWQGETLI
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atggttgtttttccacatgcgaaaataaatatcggtctctttgtgaccgggaagagaaat
gacggttttcataatctggaaacgatttttttcccggtgggatggtctgatatactcgaa
attgggcggggagaaggagaaagcgggagtttccgatttaagaataccggtctggaagtg
ggaggagatcccgggaaaaatctggtgattaaagcttatcacttgttggctgccgatttt
catttgccggccatacaagtacacttacataagatcatccctttcggtgccggtttaggg
gggggatcggcggatgcagcttttatgctgaaagctttgaatgcttttttcgatcttcgt
ctctccgggcaaaagatggtaacttatgctgcccgcctggggagtgactgtgcttttttt
atcgatgatcgtccggcatttgcttccggtaagggggagttgctggagccgatagagctt
acgttggccggttatcggatcatcatagtgaaaccctctttcggagtatctacgcctgaa
gcatatgcagggatcactccccggccggccggatatgatctgcgtcagctcggacaactt
ccggtaaatacatggaaagaatatatccggaatgattttgaagcgactgtttttcaaaaa
tatccctctctaactttattgaagcagcaattgtatgagcggggggctgaatttgtgagt
atgagcgggagcggatcggctatttatggcttgtttaagaaagaccgggaaatcaacctg
gattttcccgattgttgtgtgtggcaaggagagactttaatttaa

DBGET integrated database retrieval system