KEGG   Odoribacter splanchnicus: Odosp_0661Help
Entry
Odosp_0661        CDS       T01428                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
osp  Odoribacter splanchnicus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:osp01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:osp01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:osp00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:osp00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:osp00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:osp00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:osp00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
781528..782739
Genome map
AA seq 403 aa AA seqDB search
MRTIAILCGGGPAPGINTVVATVTKVFLKDGFRVLAIHEGYKGLFAAHPEVEELTYEKAD
QIYSRGGSAIKMSRFKPEDQDFTTALFVKEGIELLVTIGGDDTASTANRLTKYLAAHQVN
IRNIHVPKTIDNDLPLPEGIPTFGFTSAKEMGVTIGKVIKAEASTTQNWYLLMSMGREAG
HLAFEIGKGIHASMIIIPEMFNKTQITIDKIVRLIISSMIKRRIVGQKFGVVVVGEGIFH
FLQDEDIASSGITFDYDAHGHPELSEVSKAHVISKILKNRLKELNLDIICRPVEVGYSLR
CVDPSAFDLTYCTTLGIGVKKLYDEGHSGCMVAVNLEEEVIPVYLKDVEDEHGKIRTRLV
NIDKEVVRQTLAENIYYLTAQDRSLARKWLADPEPFEYERILG
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgagaactatcgcaatcctgtgtggcggaggaccggcaccgggtattaatacagttgtg
gcaactgtaaccaaagtgtttttgaaagacggattccgggttttggctatccacgaaggg
tataaaggattatttgctgcacatcccgaggtggaggaactgacttatgaaaaagccgat
caaatctacagccgtggaggctctgccataaagatgagccgttttaaaccggaagaccag
gatttcacgacagctttgtttgtaaaagaaggtattgaattgctggtgactatcggagga
gacgataccgcttcgacggctaaccgactgacgaaatatctggcagctcatcaggtaaat
atccggaatatccatgtccctaagacaatagacaatgacctgcctctgccggaaggtata
ccgactttcgggtttacttccgccaaagaaatgggggtgactatcggtaaagtgataaaa
gcagaggcatctacgacccaaaactggtatctactgatgtctatgggaagggaagccggc
cacctggctttcgagatcggtaaggggatacatgcttccatgatcattatcccggaaatg
ttcaataagacacaaattacgatcgataaaattgttcgcctgatcatatcttccatgatc
aaacgccggatcgtggggcagaaattcggtgtcgttgtagtaggtgaaggaatttttcat
tttctacaggatgaagatattgcttcttccggaatcactttcgattatgacgctcacgga
catcctgaattgtcggaagtgagtaaagcccatgtgatcagtaaaatacttaaaaaccgg
ttgaaagaactgaatctggatattatttgccgtccggtagaagtggggtattctttgagg
tgtgtggatccttcggcttttgatttgacttattgcaccactttgggaatcggagtgaaa
aaactttatgacgaaggacattccggttgtatggttgcggtaaatctcgaagaagaagta
atccctgtgtatctgaaggatgtagaagacgagcatggcaaaatccgtacccgtttggtg
aatatcgataaagaagtagtacgacaaaccctggctgaaaatatttactaccttactgct
caggatcgctctctggcgcgtaaatggctggccgatccggaaccgttcgagtatgagaga
atattaggatga

DBGET integrated database retrieval system