KEGG   Odoribacter splanchnicus: Odosp_0661Help
Entry
Odosp_0661        CDS       T01428                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
osp  Odoribacter splanchnicus
Pathway
osp00010  Glycolysis / Gluconeogenesis
osp00030  Pentose phosphate pathway
osp00051  Fructose and mannose metabolism
osp00052  Galactose metabolism
osp00680  Methane metabolism
osp01100  Metabolic pathways
osp01110  Biosynthesis of secondary metabolites
osp01120  Microbial metabolism in diverse environments
osp01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:osp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Odosp_0661
   00030 Pentose phosphate pathway
    Odosp_0661
   00051 Fructose and mannose metabolism
    Odosp_0661
   00052 Galactose metabolism
    Odosp_0661
  Energy metabolism
   00680 Methane metabolism
    Odosp_0661
Enzymes [BR:osp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Odosp_0661
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Odosp_0661
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK ACT_6 NAD_kinase
Motif
Other DBs
NCBI-ProteinID: ADY31741
UniProt: F9Z7A4
Position
781528..782739
Genome map
AA seq 403 aa AA seqDB search
MRTIAILCGGGPAPGINTVVATVTKVFLKDGFRVLAIHEGYKGLFAAHPEVEELTYEKAD
QIYSRGGSAIKMSRFKPEDQDFTTALFVKEGIELLVTIGGDDTASTANRLTKYLAAHQVN
IRNIHVPKTIDNDLPLPEGIPTFGFTSAKEMGVTIGKVIKAEASTTQNWYLLMSMGREAG
HLAFEIGKGIHASMIIIPEMFNKTQITIDKIVRLIISSMIKRRIVGQKFGVVVVGEGIFH
FLQDEDIASSGITFDYDAHGHPELSEVSKAHVISKILKNRLKELNLDIICRPVEVGYSLR
CVDPSAFDLTYCTTLGIGVKKLYDEGHSGCMVAVNLEEEVIPVYLKDVEDEHGKIRTRLV
NIDKEVVRQTLAENIYYLTAQDRSLARKWLADPEPFEYERILG
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgagaactatcgcaatcctgtgtggcggaggaccggcaccgggtattaatacagttgtg
gcaactgtaaccaaagtgtttttgaaagacggattccgggttttggctatccacgaaggg
tataaaggattatttgctgcacatcccgaggtggaggaactgacttatgaaaaagccgat
caaatctacagccgtggaggctctgccataaagatgagccgttttaaaccggaagaccag
gatttcacgacagctttgtttgtaaaagaaggtattgaattgctggtgactatcggagga
gacgataccgcttcgacggctaaccgactgacgaaatatctggcagctcatcaggtaaat
atccggaatatccatgtccctaagacaatagacaatgacctgcctctgccggaaggtata
ccgactttcgggtttacttccgccaaagaaatgggggtgactatcggtaaagtgataaaa
gcagaggcatctacgacccaaaactggtatctactgatgtctatgggaagggaagccggc
cacctggctttcgagatcggtaaggggatacatgcttccatgatcattatcccggaaatg
ttcaataagacacaaattacgatcgataaaattgttcgcctgatcatatcttccatgatc
aaacgccggatcgtggggcagaaattcggtgtcgttgtagtaggtgaaggaatttttcat
tttctacaggatgaagatattgcttcttccggaatcactttcgattatgacgctcacgga
catcctgaattgtcggaagtgagtaaagcccatgtgatcagtaaaatacttaaaaaccgg
ttgaaagaactgaatctggatattatttgccgtccggtagaagtggggtattctttgagg
tgtgtggatccttcggcttttgatttgacttattgcaccactttgggaatcggagtgaaa
aaactttatgacgaaggacattccggttgtatggttgcggtaaatctcgaagaagaagta
atccctgtgtatctgaaggatgtagaagacgagcatggcaaaatccgtacccgtttggtg
aatatcgataaagaagtagtacgacaaaccctggctgaaaatatttactaccttactgct
caggatcgctctctggcgcgtaaatggctggccgatccggaaccgttcgagtatgagaga
atattaggatga

DBGET integrated database retrieval system