KEGG   Odoribacter splanchnicus: Odosp_0661Help
Entry
Odosp_0661        CDS       T01428                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
osp  Odoribacter splanchnicus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:osp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Odosp_0661
   01230 Biosynthesis of amino acids
    Odosp_0661
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Odosp_0661
   00030 Pentose phosphate pathway
    Odosp_0661
   00051 Fructose and mannose metabolism
    Odosp_0661
   00052 Galactose metabolism
    Odosp_0661
  Energy metabolism
   00680 Methane metabolism
    Odosp_0661
Enzymes [BR:osp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Odosp_0661
Protein phosphatases and associated proteins [BR:osp01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Odosp_0661
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
781528..782739
Genome map
AA seq 403 aa AA seqDB search
MRTIAILCGGGPAPGINTVVATVTKVFLKDGFRVLAIHEGYKGLFAAHPEVEELTYEKAD
QIYSRGGSAIKMSRFKPEDQDFTTALFVKEGIELLVTIGGDDTASTANRLTKYLAAHQVN
IRNIHVPKTIDNDLPLPEGIPTFGFTSAKEMGVTIGKVIKAEASTTQNWYLLMSMGREAG
HLAFEIGKGIHASMIIIPEMFNKTQITIDKIVRLIISSMIKRRIVGQKFGVVVVGEGIFH
FLQDEDIASSGITFDYDAHGHPELSEVSKAHVISKILKNRLKELNLDIICRPVEVGYSLR
CVDPSAFDLTYCTTLGIGVKKLYDEGHSGCMVAVNLEEEVIPVYLKDVEDEHGKIRTRLV
NIDKEVVRQTLAENIYYLTAQDRSLARKWLADPEPFEYERILG
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgagaactatcgcaatcctgtgtggcggaggaccggcaccgggtattaatacagttgtg
gcaactgtaaccaaagtgtttttgaaagacggattccgggttttggctatccacgaaggg
tataaaggattatttgctgcacatcccgaggtggaggaactgacttatgaaaaagccgat
caaatctacagccgtggaggctctgccataaagatgagccgttttaaaccggaagaccag
gatttcacgacagctttgtttgtaaaagaaggtattgaattgctggtgactatcggagga
gacgataccgcttcgacggctaaccgactgacgaaatatctggcagctcatcaggtaaat
atccggaatatccatgtccctaagacaatagacaatgacctgcctctgccggaaggtata
ccgactttcgggtttacttccgccaaagaaatgggggtgactatcggtaaagtgataaaa
gcagaggcatctacgacccaaaactggtatctactgatgtctatgggaagggaagccggc
cacctggctttcgagatcggtaaggggatacatgcttccatgatcattatcccggaaatg
ttcaataagacacaaattacgatcgataaaattgttcgcctgatcatatcttccatgatc
aaacgccggatcgtggggcagaaattcggtgtcgttgtagtaggtgaaggaatttttcat
tttctacaggatgaagatattgcttcttccggaatcactttcgattatgacgctcacgga
catcctgaattgtcggaagtgagtaaagcccatgtgatcagtaaaatacttaaaaaccgg
ttgaaagaactgaatctggatattatttgccgtccggtagaagtggggtattctttgagg
tgtgtggatccttcggcttttgatttgacttattgcaccactttgggaatcggagtgaaa
aaactttatgacgaaggacattccggttgtatggttgcggtaaatctcgaagaagaagta
atccctgtgtatctgaaggatgtagaagacgagcatggcaaaatccgtacccgtttggtg
aatatcgataaagaagtagtacgacaaaccctggctgaaaatatttactaccttactgct
caggatcgctctctggcgcgtaaatggctggccgatccggaaccgttcgagtatgagaga
atattaggatga

DBGET integrated database retrieval system