KEGG   Odoribacter splanchnicus: Odosp_0788Help
Entry
Odosp_0788        CDS       T01428                                 

Definition
(RefSeq) tryptophan synthase subunit alpha (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
osp  Odoribacter splanchnicus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:osp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Odosp_0788
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Odosp_0788
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Odosp_0788
Enzymes [BR:osp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Odosp_0788
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(935665..936447)
Genome map
AA seq 260 aa AA seqDB search
MNRITELFQRKDRNLLSVYFTAGYPVLEDTVEIIQMLENRGVDLVEIGIPFSDPMADGVV
IQQSSTQALKNGMTLPVLLEQLTSIRSRVELPLLLMGYLNPMLRYGIENLFRKGMEIGID
GMIIPDLPFQEYLESVKPLCEKYDIPVIMLITPETSDERIRLIDEYCGGFIYMVSSASTT
GVKDRFTAGQIEYFQRIDRLNLKNKRLIGFGISNGESLSTVCRYSSGAIIGSLFVKLLGT
EPTVEEAVDHLLKIAHGDGL
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgaatcggattacagagttgtttcaaagaaaagatagaaatcttttgtccgtgtatttt
actgccggttatccggttttggaagatacggtcgaaatcatacagatgttagaaaaccgg
ggagtcgatctggtggaaatcgggattcctttttccgatcctatggccgatggggtagtc
atccagcaaagtagtacacaggcactgaaaaatggcatgacgttgcctgtattactcgag
cagttgactagtatacgaagtcgggttgaattgcctttgctattgatgggatatttgaat
ccgatgttgcggtacggtatagaaaacctttttcgaaaagggatggaaatcgggatcgat
ggaatgattattccggatttgccgtttcaggaatacctggagtcggttaaaccgctttgt
gaaaaatatgatattccggtgattatgttgattacccccgaaacttcggatgaaaggatc
cgtctgatagacgaatattgtggcggttttatctatatggtctcttcggcttcgacgacc
ggagtgaaagatcggtttacagccggacagattgaatatttccaaagaatagaccgtttg
aatttgaaaaataaacgtttgatcggtttcggcatatctaatggcgagagcttgtcgacc
gtttgccgttatagtagcggagctattatcggaagcttatttgtaaaattactgggaacg
gagcctacggtggaggaagctgtcgatcacttgttaaaaatagctcacggggacgggcta
tag

DBGET integrated database retrieval system