KEGG   Odoribacter splanchnicus: Odosp_1121Help
Entry
Odosp_1121        CDS       T01428                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
osp  Odoribacter splanchnicus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:osp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Odosp_1121
   01230 Biosynthesis of amino acids
    Odosp_1121
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Odosp_1121
   00051 Fructose and mannose metabolism
    Odosp_1121
   00562 Inositol phosphate metabolism
    Odosp_1121
Enzymes [BR:osp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Odosp_1121
Exosome [BR:osp04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Odosp_1121
  Exosomal proteins of bladder cancer cells
   Odosp_1121
  Exosomal proteins of melanoma cells
   Odosp_1121
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1333443..1334210
Genome map
AA seq 255 aa AA seqDB search
MRKKIVAGNWKMNKTLQEGIELAKEVNSKVKAANAKDVKVIIGTPFIHLAEVSKMVDPAV
IAVSAQNCATEVSGAYTGEVSAAMVASTGSRYVILGHSERRSYYGETDEILVKKVQRALE
NNLDVIFCVGEVLAEREAGKHFEVVKSQLVNGLFNLSADQFAHIVVAYEPVWAIGTGKTA
TSAQAEEMHAFIRKTIADKYGKEVADNTSILYGGSCNPKNADELFCQADVDGGLIGGASL
KADDFMAIITARQKH
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaaaaattgttgccggtaactggaaaatgaacaaaaccctgcaggaagggatt
gaactggctaaagaggtaaacagcaaagtaaaagctgctaatgcaaaggatgtgaaggtc
atcatcggtacccctttcattcatctggccgaagtaagtaaaatggtagatcctgcagtc
attgccgtatctgcacaaaactgcgctacagaagtctccggagcatataccggtgaagta
tccgcagctatggtggcctctaccggaagccggtatgtcattctcggtcactctgaaaga
agaagctattacggagaaaccgatgaaatcctggttaagaaggtacaacgtgccctggaa
aataacctggatgtcattttctgcgtcggagaagttttagccgagagggaagccggcaaa
catttcgaagtagtaaaatctcaattggtaaacggtttattcaacctctctgccgatcag
ttcgcacacatcgtcgtagcttacgaaccggtatgggctatcggtaccggcaaaacagcc
acctctgcacaagctgaggaaatgcatgcctttatccgtaaaaccatcgccgacaaatat
ggtaaagaagtagctgacaacacctcgatcttatacggcggaagctgcaaccccaaaaat
gccgacgaactattctgtcaggcagacgtcgacggtggccttatcggcggagcttccctg
aaagccgacgactttatggctatcattacggcacggcagaagcattaa

DBGET integrated database retrieval system