KEGG   Odoribacter splanchnicus: Odosp_1351Help
Entry
Odosp_1351        CDS       T01428                                 

Definition
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
osp  Odoribacter splanchnicus
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:osp00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:osp00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1601971..1603434)
Genome map
AA seq 487 aa AA seqDB search
MKKLKELLNGVNVGKVYGDTDREIGHIHFDSRKIEPGDVFIAQRGVNADGHAFIDKALTR
GAVAVVCEQLPENRPEEVTYIWTADTSEALGVMAGNYWDNPSRELKLVGVTGTNGKTTTA
TLLYELVRLAGEKAGLLSTVCNYIGEEKIPATHTTPDALSIQELLRRMVDAGCRYCFMEA
SSHAIHQKRIAGLDFDGAIFSNITHDHLDYHKTFKAYIEAKKAFFDRLPAHAFALTNADD
KNGLVMLQNTRAHRYTYSCRTMADFTAKAIEKHLDGTLLRLDGEEVWTKFTGDFNAYNLL
AVYAAARLLGFPKENVLEYVSLLVPVSGRFETLISTEGVMAVVDYAHTPDAVENVLSTIC
GLKGRDNQVITVVGAGGDRDKTKRPEMADAACRYSDHVILTSDNPRSEDPEQIIRDMLTG
VKEGFQYRVEAITDRKEAIRKAIGMASKGDIILVAGKGHENYQEVKGVKHHFDDKEVIRE
IFDLSNR
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaattaaaggaattattaaacggagtaaatgtcggaaaagtatatggggatacc
gaccgggagatcggacatatccatttcgattcacgcaaaatcgaaccgggagatgtattt
atcgctcagagaggagtcaatgcggacggacatgcttttatcgacaaagcgttgacccgc
ggggctgttgcggtagtgtgtgaacaattgccggaaaacagaccggaagaggtaacttat
atatggactgcagatacctccgaggctttgggagtaatggccgggaattactgggataat
ccttcccgggaactgaaactggtcggggtgacggggacaaacggaaagacgacgacggca
accttgttgtacgaactggttcgattggccggagaaaaggccggactgttgtcgacggta
tgtaactatatcggggaggaaaagattccggcgacacatacaactccggatgcgctgtct
atccaggaattattacggcggatggtagatgccggatgccggtattgttttatggaagcc
agttcgcatgcgatccatcagaaaaggattgccggtctggatttcgacggggctattttt
tccaatattacgcacgatcatctggattatcataaaacattcaaggcttatatcgaagcg
aagaaagcttttttcgaccgtttaccggcccatgcttttgctttgactaatgcagatgat
aaaaatggcctggtgatgttgcagaataccagggcacaccgatatacctattcttgccgg
acgatggctgattttacagctaaagcgatcgagaaacatttggacggaaccttgctccgg
ctcgacggagaggaggtatggaccaagtttaccggtgatttcaacgcttacaatctgtta
gcagtatatgctgcagcccgtttgttggggttcccgaaagagaacgtgttggaatatgtg
agtttgctggtgccggtgtccggacgtttcgaaactttgatttcgaccgaaggagtgatg
gcggtggtcgattatgcccatactccggatgctgtagagaatgtattgtcgacgatttgc
ggattgaagggcagagataatcaggtgattaccgttgtgggagccggaggcgaccgcgat
aagaccaaacgtccggagatggctgatgcagcttgccgttatagtgatcatgtcatcctc
acttccgataatccgcggagtgaagatcccgaacagatcatccgtgatatgctgaccgga
gtgaaagaaggatttcagtaccgggtagaagccattaccgaccggaaagaggctatccgg
aaagcgattggtatggcttcaaaaggagacatcatattggttgccggtaaaggacatgaa
aattatcaggaagtgaaaggagtaaaacaccacttcgacgataaggaagttatccgggag
atttttgatctctctaatcgctaa

DBGET integrated database retrieval system