KEGG   Odoribacter splanchnicus: Odosp_1715Help
Entry
Odosp_1715        CDS       T01428                                 

Definition
Recombination protein recR
Orthology
K06187  
recombination protein RecR
Organism
osp  Odoribacter splanchnicus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:osp00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Odosp_1715
DNA repair and recombination proteins [BR:osp03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Odosp_1715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2042331..2042942
Genome map
AA seq 203 aa AA seqDB search
MNSSRLLDKAVDQFASLPGVGRKTALKFVLHLLKKDVQEVDDFLKSIGDLKKNIKECRRC
HNISDGEICEICSDPKRDNTTLCVVENIKDILSIEATSQYNGLYHVLGGIISPMDGIGPA
DLHITSLVERVEQEPIREIIFALSATIEGDTTGYYIFKKMKNKEDLVISTIAKGISIGND
LEYTDELTLGRSIVNRVKFSFND
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
gtgaattcttcaaggttattagataaagcggtcgatcagtttgcttccctgccgggagta
gggcgtaaaacagctctgaaattcgtattacatcttctgaagaaagatgtgcaggaagtc
gacgactttttgaaaagtatcggtgacctgaagaaaaacatcaaggaatgccgtcgatgt
cataatatttccgacggtgaaatctgcgagatctgttcagacccgaaacgagataacacg
acgctctgcgtcgtagaaaacatcaaagacatcttatcgatcgaggccacctcacaatac
aacggtttataccatgtgctcggaggaatcatctctccaatggacggtatcggtcctgcc
gatctgcacattacttctttagttgaaagggtagagcaggaaccgatccgggaaatcatc
tttgccctcagtgccaccatcgaaggagatactaccggctattatatcttcaaaaaaatg
aagaataaagaagatctcgtcatcagcaccattgccaaaggcatctctatcggcaatgat
ctggaatataccgacgagctgactttgggacgttccattgtcaatcgtgtcaaattcagc
ttcaacgattag

DBGET integrated database retrieval system