KEGG   Odoribacter splanchnicus: Odosp_2058Help
Entry
Odosp_2058        CDS       T01428                                 

Definition
Acetaldehyde dehydrogenase (acetylating) (EC:1.2.1.10 1.2.1.16)
Orthology
K18119  
succinate-semialdehyde dehydrogenase [EC:1.2.1.76]
Organism
osp  Odoribacter splanchnicus
Pathway
Butanoate metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:osp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Odosp_2058
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Odosp_2058
Enzymes [BR:osp01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.76  succinate-semialdehyde dehydrogenase (acylating)
     Odosp_2058
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2454241..2455596)
Genome map
AA seq 451 aa AA seqDB search
MEIKEMVVKARKAQEIYEHHFDQDQVDRVIREAARVIYDHAEELARLAVNETGMGVYEHK
VAKNRNKSKGVYYNLRGKKSMGIIDMDEKTGLIEIAKPIGVVAGITPMTNPIVTPMSKII
FALKTKNAIIIAPHPQSKRCSALAVNLIKDVVAPFGVPADLIQVIDEPSIDKTKELMEAC
DVVVATGGMPMVKSAYSSGKPSFGVGAGNVQVILDRNIDLEAAAEKVITGRAFDNGIICS
GEQFFTYPVTDREAVFKAFTAHGAYFVTAGEKERLLNVLFPEGKINRALVGQSVKKIAGA
AGIDLPEGIRVIVAEATGAGHADRICKEKMFPVMGCLGYDNFEEALRIAKTNLNMEGNGH
TAGIHSNDQANVIKAGTELSVSRLIVNAPCATTAGGSIQNGLPVTNTLGCGSWGNNSISE
NFTYKHLLNITRIAPLSARIHVPSDEEIWAD
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atggaaataaaggaaatggtggtgaaagcccgcaaggctcaggagatttacgaacatcat
tttgaccaggatcaggtcgaccgggttatccgcgaagctgcccgtgtcatttatgatcat
gccgaagaattggcccggttggctgtaaacgaaaccggcatgggggtgtatgagcacaaa
gtagctaaaaaccgcaataaatcgaaaggggtttattataacctgaggggtaaaaaatcc
atgggtatcatcgatatggatgaaaaaaccggattgatcgaaattgccaaaccgatcggt
gtggtagccgggatcacgccgatgaccaatccgattgtgacaccgatgtcgaagattatt
tttgccctcaaaaccaaaaacgccattattatagctccgcatccacagtcaaaaagatgc
tcggctctggctgtaaatctgatcaaggacgttgtggctccgttcggggttcctgccgat
ctgatccaggtgatcgacgaaccttctatcgataagaccaaagaattgatggaagcctgc
gatgtcgttgttgccacaggagggatgccgatggtgaaatccgcttactcttctggaaaa
ccctctttcggtgttggtgccggtaatgtacaggtgatccttgatcgtaatatcgatctg
gaggcagcagctgaaaaggtgattaccggacgtgcttttgataatggtattatctgttcc
ggagaacaatttttcacttatccggtaaccgatcgcgaagctgtgttcaaggcctttact
gcacatggggcttattttgttactgccggagagaaagagcgtttgctgaatgtactcttc
ccggaaggaaaaataaaccgggctttggttgggcagtcggtgaagaagattgccggtgct
gccggtatcgatctgcctgaaggtatccgtgtcattgtagctgaagcaaccggagccgga
catgccgatcgtatctgcaaagaaaaaatgtttccggtaatgggttgcctcggatatgac
aattttgaagaagccttacggatcgccaagactaacctgaacatggaaggtaacggtcat
acagccggaattcattccaacgatcaggccaatgtgattaaggccggcaccgaattgtcc
gtttcccgtctgattgtgaacgctccttgtgcaaccactgccggtgggtctattcagaac
ggtctgcctgtaaccaatacgttgggatgcggaagctggggaaataattcgatttcggag
aattttacttataaacatttattaaatatcacccggattgctccgctgtcggcacgtatc
catgtgccttcggatgaagagatctgggcggattga

DBGET integrated database retrieval system