KEGG   Odoribacter splanchnicus: Odosp_2084Help
Entry
Odosp_2084        CDS       T01428                                 

Definition
aldose 1-epimerase (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
osp  Odoribacter splanchnicus
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:osp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Odosp_2084
   00052 Galactose metabolism
    Odosp_2084
Enzymes [BR:osp01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Odosp_2084
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2485220..2486194)
Genome map
AA seq 324 aa AA seqDB search
MKPQIYILKNTHLEVHISTLGATLTRMLTKDLQGKVVDVLLGMEKAEDYESPEYIASGAY
LGAIIGRYGNRIARGRFEIDGVKYQLAINNGENHLHGGLCGFDKKIWNVGQAGTDSLTLT
YCSPDGEEAYPGTLQVKVGFSLQEKALRIDYEAVTDKKCFVNLTHHPYFNLNPEAADIKR
HTLKLYTDRYLKTDDLIPDGTFVTATGDYDFTSPASLQGVIGNQGGLDDCFVFNNSGKLI
RMAELFDDQTGIKLYVCSDYPGVQVYTGKFLNVKQAKDGKQYGPYAGVALEAQFWPDSPN
HPEFPSTLLVPGEIYRKTTIYGFE
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccacagatctatatattgaaaaatacgcacctcgaagtacatatttctacttta
ggggcaactttaacccgcatgctgacgaaagatttgcagggaaaggttgtagatgtgttg
ctgggtatggaaaaggccgaagattacgaatcgccggaatatattgctagcggagcttat
ctgggagcgataatcggacgttatgggaatcggattgcccggggaagatttgagatcgac
ggtgtaaaatatcagttggcgataaataatggtgaaaaccatctgcatggaggattgtgt
ggtttcgataaaaagatctggaacgtcggacaagccggtacagattcgctgacgttgact
tattgcagtcccgacggcgaagaagcctatccgggaacactacaggtgaaagtcgggttt
tcgctgcaggagaaagctttacgaatcgattatgaagctgttaccgataaaaaatgtttt
gtcaatctgactcaccatccttattttaacctgaatccggaggctgccgatattaaacga
cataccctgaaattatataccgaccgctatttaaagaccgacgatttgattccggacggg
acttttgttacggctaccggagattatgatttcacttcgccggcatctttacaaggtgtg
atcggaaaccagggaggactggacgactgttttgtattcaacaattccgggaaactgatt
cgaatggcagaactttttgatgatcagacaggtataaaactttatgtatgttccgattat
ccgggagtgcaagtgtacacgggaaaatttctgaatgtaaagcaggctaaggatggtaaa
caatacggaccttatgccggagtagctctggaagctcagttctggcccgattctcccaat
catcctgagtttccgtctacacttttagtgccgggagaaatttatcggaaaacgaccatt
tatggttttgaatga

  All links  
No link information was found.   
DBGET integrated database retrieval system