KEGG   Odoribacter splanchnicus: Odosp_2447Help
Entry
Odosp_2447        CDS       T01428                                 

Definition
Beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
osp  Odoribacter splanchnicus
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osp00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Odosp_2447
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Odosp_2447
Enzymes [BR:osp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Odosp_2447
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2929910..2931979
Genome map
AA seq 689 aa AA seqDB search
MSFVRNLFFSVFLGVWGTLSAQEERVIPVPREVLPGTGEFRMSEVTAWHTNLSGAEKESL
VNYAAAELSTGRQEWHGKDHTGKDVVFFQKISDAGIHPEGYVLEVKPEIVTVSASTATGL
FYGLQSLLQLMKPDERGGWTVPAVTVKDSPRFGYRGFMIDVSRHFRPKEFVKKQIDAMAR
YKLNRLHLHLTDAAGWRIEIKKYPRLTSFAAWRPEAEWKKWWNTAGGRKYCEREDPAAQG
GYYTQEDIRELVRYAAERHITIIPEIEMPAHSEEVLAAYPGLSCAGEPYKGSDFCVGNEE
TFTFLENVLTEVMALFPSEYIHIGGDEAGKQAWKSCPKCRRRMADEELKNEDELQSYLIC
RVEKFLNGHGRKLLGWDEIMEGGLAPNATVMVWRGEEGGVRAVKAGHRVVMTPGKFCYLD
SYQDAPQFQPEASGGYLPLANVYSYDPVSPAFTEEEAKLIYGVQGNLWAEYIPTDEHYEY
MAYPRLLAIAEVAWSEPANKSYPDFRGRVCREIGWLRDRGYHPFPLEQELGERPEAKERV
VHLALGKPVVYNAPYNEHYKAQGDKTLTDGIRGGWTYSDGAWQGFISRDRLDVTIDLGKA
ICITSVEATFIQVVNPEVFLPCEVIVSFSTDGKNFVEAKREEYKVSKEKPVCFGNFGWTG
CASTRYVRYQARSDKDLRGWLFTDEIIVK
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtttgtacggaatttgtttttcagcgtgttcctgggtgtctggggaacattgtcg
gcacaggaggaaagggtgattcctgtcccgagggaagtactcccgggaacgggagagttc
cgtatgtcggaagttacggcatggcacaccaatctgagtggagcggagaaggaaagttta
gtcaattacgcggcagcggagttatctacggggagacaagaatggcacggaaaagatcat
acgggcaaggatgtcgtattttttcaaaaaatatccgatgcgggcattcatcccgaaggg
tatgttttggaagttaaaccggaaatagtgacggtatcggcctctaccgcaaccggtttg
ttttacggtttgcagtcattgctgcaattgatgaagccggatgaacggggaggctggaca
gttccggccgtgacggttaaagactccccgcggttcgggtaccgcggattcatgatagat
gtttcgcgtcatttccgcccgaaggagtttgtcaagaagcagatagacgctatggcccgt
tataagttgaaccgcttgcatttgcatttgacggatgccgccggttggcgtatcgagatc
aaaaaatacccgaggctcacaagttttgcagcgtggcgcccggaagcggaatggaagaaa
tggtggaatactgccggtggacgcaagtattgcgagcgggaggatcctgccgctcaaggc
gggtattacacgcaggaggatatccgggagctggtgcgttacgcggcggaacgccatatc
acgataattcctgagatagagatgcctgcccattcggaagaggtattggcggcttatccc
ggtttatcgtgtgcgggtgaaccttataaggggtctgatttttgcgtgggtaacgaggaa
acgtttacttttctggaaaatgtacttaccgaggtgatggcgcttttcccgtcggaatat
attcacatcgggggcgatgaggctggcaaacaggcatggaagagttgtccgaaatgccgg
cggcggatggcggacgaggagttgaagaacgaggatgaattacagagttatctgatttgc
cgtgtggagaagtttttgaacggccacgggcgtaagttgttgggatgggacgagatcatg
gaaggcgggttggctccgaatgccacggtgatggtgtggcggggcgaggaaggcggagta
agggccgtgaaagccgggcatcgtgtcgtgatgactcccggaaaattttgttatctggat
agttaccaggatgcaccgcagtttcagccggaagcaagcggggggtatttgccactggct
aacgtgtattcgtatgacccggtatctcccgcgttcacagaggaagaggcgaaattgatt
tatggcgtgcagggcaatttgtgggcggagtatatccctaccgatgaacattacgaatat
atggcttatccccgtttgttggctatcgctgaagtggcgtggagtgaacctgccaacaag
tcatatcctgattttcgcgggcgggtatgccgggagatcggatggttgcgtgaccggggg
taccatccttttcccctggagcaagagttaggggaacgtcccgaagcaaaggaaagggtc
gttcatttggcattggggaagccggtggtgtacaatgctccttataacgaacattacaaa
gcgcagggggataagaccctgacggatggcatccgcgggggatggacgtattccgatggt
gcgtggcagggatttatatcgcgggaccgcctcgatgtaactatcgacctggggaaagcc
atttgcataacttccgtggaggcaacttttattcaagtggtgaatcccgaggtgtttttg
ccgtgcgaagtgatcgtttctttctcgacagacgggaagaatttcgtggaagcgaagcga
gaggaatacaaggtatcgaaagaaaaaccggtctgctttggaaacttcggttggacagga
tgtgcctcgacccgttacgtgcgttaccaggcccgttcggacaaggatttacgcggttgg
ttgttcacggacgaaatcatcgtgaagtaa

DBGET integrated database retrieval system