KEGG   Odoribacter splanchnicus: Odosp_2818Help
Entry
Odosp_2818        CDS       T01428                                 

Definition
glycoside hydrolase 2 TIM barrel
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
osp  Odoribacter splanchnicus
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:osp00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:osp00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3358839..3362888)
Genome map
AA seq 1349 aa AA seqDB search
MRIITLSLLLCGLVIQSFGVRPPLKGYTYASEQAPTGKEWQSPENLALNKEQPHAWFFPF
QDIKSARKVLPENSIYWQSLNGNWKFNWAADPDSRPKDFYKTDFDVTAWDNIPVPSSWNI
YGVQQDGSLKYGVPIYVNQPVIFMHSVKADDWRGGVMRTPPTNWTTYKYRNEVGSFRREF
EIPEHWDGREVFISFDGVDSFFYLWINGMYVGFSKNSRNTANFNITNYLRSGKNIVAAEV
YRNSDGSFLEAQDMFRLPGIFRTVALYSTPKVQIRDLVATPDLDNNYTDGSLTIQADIRN
FGKKTAKGYKVCYSLYANKLYSDENEPVILARDTKGAAIRNSVVAQVEPITTGNTQEAEK
VVLKVKNPNKWSAETPYRYTLIAELKDHKNRSIETVSTIVGFRKVEIKDTPADQDEFGLA
GRYYYVNGKTIKLKGVNRHETNPAVGHAITREMMEKEVMLMKQGNINHVRNSHYTDDPYW
YYLCNKYGIYLEDEANIESHEYYYGAASLSHPVEWKNAHVARVMEMVHSNVNNPSIVIWS
LGNEAGPGQNFVAAYEALKQFDLSRPVQYERNNSIVDMGSNQYPSIGWVRGAVKGNYDIK
YPFHISEYAHSMGNACGNLIDYWEAIESTNFFCGGAIWDWVDQSMYNYDKKTGKRYLAYG
GDFGDIPNDGQFVMNGIVFGDLEPKPQYYEVKKVYQNMAVKAIDIEKGQFGIFNKYYFKD
LSDYDVKWSLYENGKEIQSGPVTTGIVPARHTVQVVIPYQYNNLKKDSEYFVKVQFLLKN
DMPWARKGFVVAEEQIQVKEAHRPLISTMIRQGGKLTCDKSRTARPVIQGNNFKVEFDES
TGTIYSLTYDSTTIIAAGNGPKLDVLRAFTNNDNWFYSSWFDRGLHHLQHKAKETTIMNK
PDGSIVLAFTVESQAPHAAKILGGTSSGKNTIEELTDTPFGPNDFKFTTNQIWTVYPDGS
IELQASVTSNQPDLVLPRLGYAMKIPQEYANFTYYGRGPIDNYADRKSGQFIEQHKNTVA
GEFVNFPKPQDMGNHEDVRWCALTNQANQGAVFIATDRLSVSALPYSAQDLILASHPYQL
PQAGDTWLHLDAAVTGLGGNSCGQGGPLVADRVFANNHNFGFIIRPAGKDLSKIANIAPA
GEIPLSITRSKSGTVEITSARKNATICYTVGKSKVKEYTTPISLREGGLVTAWFKDRPAI
KTKISFEKQENIQTVVIYASSQEAGEGDASHLTDGDPNTIWHTMYSVTVAKYPHWVDLDA
GEVKNIKGFIYLPRQDGNNGKIKDYSIQVSMDGKNWGTPVQKGTFDNSSKEKQVEFAKPV
QARYIRFTALSEQNGQDFASGAEITILAE
NT seq 4050 nt NT seq  +upstreamnt  +downstreamnt
atgcgtataatcacattaagtctattactgtgtggtttagtcatacaaagcttcggtgta
cgaccgccgttaaaaggttacacctatgcttcggaacaggctccaacaggaaaagagtgg
caatctccggaaaatctggctctaaacaaagagcagccacatgcttggttttttcctttt
caagatataaaaagtgcccgaaaagttctgcctgaaaacagtatatattggcaatcgctg
aacggtaactggaaattcaactgggcagcggatccggattcacgtcccaaagatttttat
aaaaccgatttcgacgtgacggcttgggacaatattccggttccttccagctggaatatt
tatggagttcagcaagatggcagtttgaaatacggagtacccatctatgtcaatcaacct
gtcatttttatgcatagcgtaaaagcagacgactggcggggtggcgtaatgcgtacgcct
ccaacgaactggacaacttacaaatatcgcaatgaagtgggttctttccgtcgggaattc
gagattcccgaacactgggacggacgtgaagtatttatcagttttgacggagtcgattca
tttttctatctatggatcaacggaatgtatgtaggtttttcgaaaaactcacgcaatacg
gctaatttcaatattaccaactatttgcgttccgggaaaaacatagtcgcagcagaggtt
taccgaaattccgacggttctttcctggaagctcaggatatgttccgtttgccaggtatt
ttccgcaccgtagcactttattccacccctaaagtacagatacgtgatctggttgcaact
ccggatttggataataactacaccgacggttctctgacaattcaggccgatatccgtaat
tttggaaagaaaacggccaaaggatataaagtatgctatagtttgtatgccaacaaattg
tattctgacgagaatgaaccggttattctggctagagatactaagggagcggctatccgg
aacagtgtcgttgcccaggtagaacctattaccacaggaaatacccaggaagcggaaaaa
gtggttctgaaagtaaaaaatccgaataaatggtcggcagaaactccttatcgttatacc
ctgatcgcggaactgaaagatcataaaaaccggagtatcgagacagtatctacgattgtc
ggtttccggaaagtggaaatcaaagacactccggctgatcaggatgagttcggcctggcc
ggccgttattactatgtcaacggcaagacgataaaattaaaaggggtgaaccggcatgaa
accaacccggctgtaggtcacgctataacccgtgagatgatggaaaaagaggttatgctg
atgaagcaaggtaatatcaatcatgtacgtaactcacattataccgacgatccttactgg
tattatctctgtaataaatacggcatttatctggaagatgaagccaacatcgaatcacat
gaatactattacggggcggcttctctttctcatcccgttgaatggaaaaatgcacatgtc
gcccgggtaatggaaatggtacacagcaatgtaaacaatccttctatcgtcatctggtcg
ctgggaaatgaggcaggccccggccaaaactttgtcgctgcctacgaagctttaaaacaa
ttcgatttatcccgtccggtacaatacgaacggaacaattcgattgtggatatgggttcc
aaccaatatccttctatcggttgggtacggggagctgtaaaaggaaattatgatattaaa
tatccgttccatatctcggaatatgcccattccatgggtaatgcctgtggaaatctgatc
gactactgggaagctatcgaatctactaatttcttctgtggcggtgccatttgggattgg
gtggatcagtcgatgtataattatgacaagaaaaccggtaagcgttatctggcctatgga
ggagatttcggagatatccccaatgacggtcagtttgtaatgaatggtattgtatttgga
gatcttgaacctaaaccacaatattatgaagtgaagaaagtctatcagaatatggctgtg
aaagcgattgacatcgagaaaggtcaattcgggatattcaacaaatattattttaaagac
ctttcggattatgatgtaaaatggtccttatatgaaaatggcaaggaaatacaatccggt
cctgtgactacaggcattgttcctgcccgccatacggtacaggtagttattccttatcaa
tacaataatctgaagaaagattccgaatatttcgtaaaagtgcagtttttactgaaaaac
gatatgccttgggcgagaaaaggattcgtggttgcagaagaacaaattcaggtgaaagaa
gcccaccggcctctcatcagcacgatgataagacaaggcggaaaactgacctgcgacaaa
agcaggactgcccgccctgtgatccaagggaataatttcaaagtcgagttcgatgaatcc
acaggaacgatttacagtctgacttatgattcaacaacaatcatagcagcaggtaatgga
ccgaaactggatgtactccgtgcttttacgaacaatgacaactggttctattcttcgtgg
tttgaccgtggtttacaccatttacaacacaaagccaaagaaacaacgattatgaataaa
ccggacggaagtattgtattggcttttacagtagaatcccaggcgcctcatgcagcaaaa
atactgggtggtaccagttccggtaagaatacgatcgaagaattaaccgacacccctttc
ggtccgaacgatttcaaattcactaccaatcagatttggacggtttatccggatggttcc
attgaattacaggccagtgttacttccaatcagcctgatctggtattaccccgtttgggt
tatgccatgaaaatccctcaggaatatgccaattttacctactacggacgtggtccgatc
gacaattatgcagaccggaaaagcggacagttcattgaacagcataagaatacggttgcc
ggagaatttgtcaacttcccgaaacctcaggacatgggaaatcatgaagatgtgcgttgg
tgtgccctaaccaatcaggcaaatcagggggctgtatttatagccaccgatcggttatcc
gtctccgctttaccatattcggcccaggatttgattctggcttcccatccttatcagttg
ccacaagccggcgacacctggttgcatctggatgcagcagtgacaggactgggaggaaac
agttgcggtcagggtggtcctttggtagcggaccgggttttcgccaacaatcacaatttc
ggatttatcattcgtcctgccggtaaagacctgagtaaaatagccaatatcgctcctgcc
ggagaaattccattgtctatcacacgtagtaagtcgggaactgtagaaataacctcagcc
cgtaagaatgcaacaatttgctacaccgttggaaaaagcaaagtaaaagaatacacaacc
ccgatatcacttcgtgaaggaggtctggtaactgcctggttcaaagacagacctgctatc
aaaacgaagatttcctttgagaagcaggaaaacatccaaactgttgtgatctatgccagc
agccaggaagccggagagggagatgcttcacacctcacagacggagatcccaatacaatc
tggcatacgatgtattccgtaacagttgccaaatacccgcattgggtggatctggatgcc
ggagaagtgaagaatatcaaaggtttcatttacttaccccgccaagacggcaataacggt
aagatcaaagattatagcatccaggtaagcatggacggtaaaaactggggaactcctgtt
cagaaaggtactttcgataatagcagcaaagagaagcaagttgagtttgccaaaccggtg
caagcccgttatatccgtttcacagctttaagcgaacagaacggtcaggactttgcctcc
ggtgccgaaataacgattctggcagaataa

DBGET integrated database retrieval system