KEGG   Odoribacter splanchnicus: Odosp_2846Help
Entry
Odosp_2846        CDS       T01428                                 

Definition
sugar-phosphate isomerase, RpiB/LacA/LacB family (EC:5.3.1.6)
Orthology
K01808  
ribose 5-phosphate isomerase B [EC:5.3.1.6]
Organism
osp  Odoribacter splanchnicus
Pathway
Pentose phosphate pathway
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:osp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Odosp_2846
   01230 Biosynthesis of amino acids
    Odosp_2846
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Odosp_2846
   00051 Fructose and mannose metabolism
    Odosp_2846
Enzymes [BR:osp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     Odosp_2846
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3392230..3392661
Genome map
AA seq 143 aa AA seqDB search
MKIAIACDHAGYEYKEKLVAFLRQKGYEVKDFGTHSAESMDYPDTAHPMAAAVESGEFER
GIALCGSGNGICMTVNKHQGIRGALCWTTEIAWLARLHNNANVCCIPARFISFDDAQDIV
ERFLSTEFEGGRHQRRIEKIPLK
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatagctattgcctgtgaccatgccggttacgaatacaaagaaaaattagtggca
ttccttcgccagaaaggttatgaagtaaaagatttcggtacacattctgctgaaagtatg
gattatcccgatactgcccatccgatggctgctgctgttgaatccggcgagttcgagaga
ggaatcgcgctctgtgggagtgggaatgggatttgtatgactgtcaataaacatcagggt
atccggggtgcactctgttggacgaccgaaatcgcctggttggcacgcctccataacaat
gccaacgtatgttgtatccctgcccgttttatctccttcgacgatgctcaggatatcgtc
gagcgttttctgtctaccgaatttgaaggcggaagacaccagagaagaatcgagaaaatt
cccctaaaataa

DBGET integrated database retrieval system