KEGG   Odoribacter splanchnicus: Odosp_2846Help
Entry
Odosp_2846        CDS       T01428                                 

Definition
(GenBank) sugar-phosphate isomerase, RpiB/LacA/LacB family
  KO
K01808  ribose 5-phosphate isomerase B [EC:5.3.1.6]
Organism
osp  Odoribacter splanchnicus
Pathway
osp00030  Pentose phosphate pathway
osp00051  Fructose and mannose metabolism
osp01100  Metabolic pathways
osp01110  Biosynthesis of secondary metabolites
osp01120  Microbial metabolism in diverse environments
osp01130  Biosynthesis of antibiotics
osp01200  Carbon metabolism
osp01230  Biosynthesis of amino acids
Module
osp_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
osp_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:osp00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Odosp_2846
   00051 Fructose and mannose metabolism
    Odosp_2846
Enzymes [BR:osp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     Odosp_2846
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LacAB_rpiB UPF0180
Motif
Other DBs
NCBI-ProteinID: ADY33823
UniProt: F9Z5S2
Position
3392230..3392661
Genome map
AA seq 143 aa AA seqDB search
MKIAIACDHAGYEYKEKLVAFLRQKGYEVKDFGTHSAESMDYPDTAHPMAAAVESGEFER
GIALCGSGNGICMTVNKHQGIRGALCWTTEIAWLARLHNNANVCCIPARFISFDDAQDIV
ERFLSTEFEGGRHQRRIEKIPLK
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatagctattgcctgtgaccatgccggttacgaatacaaagaaaaattagtggca
ttccttcgccagaaaggttatgaagtaaaagatttcggtacacattctgctgaaagtatg
gattatcccgatactgcccatccgatggctgctgctgttgaatccggcgagttcgagaga
ggaatcgcgctctgtgggagtgggaatgggatttgtatgactgtcaataaacatcagggt
atccggggtgcactctgttggacgaccgaaatcgcctggttggcacgcctccataacaat
gccaacgtatgttgtatccctgcccgttttatctccttcgacgatgctcaggatatcgtc
gagcgttttctgtctaccgaatttgaaggcggaagacaccagagaagaatcgagaaaatt
cccctaaaataa

DBGET integrated database retrieval system