KEGG   Odoribacter splanchnicus: Odosp_3085Help
Entry
Odosp_3085        CDS       T01428                                 

Definition
Beta-galactosidase (EC:3.2.1.23)
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
osp  Odoribacter splanchnicus
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osp00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Odosp_3085
  Lipid metabolism
   00600 Sphingolipid metabolism
    Odosp_3085
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Odosp_3085
Enzymes [BR:osp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Odosp_3085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3658405..3661497
Genome map
AA seq 1030 aa AA seqDB search
MKKLLLCLGLCLSMTTFAQKKEWLDPELNAINRAPARADYFAYPSREMAEQGVREESSNF
LSLNGMWKFNWVKDQTERPVNFYRLDFEDQYWVDFPVPGIWEMNGYGDPLYRNSGYAWSN
QFTPDPPKIETVNNHVGSYRKTVEIPASWKGQQVFLHVGSATSNLYVWVNGKFVGYSEDS
KLAAEFDITGYVRPGKNLIAMQVYRWCDGSYLEDQDFWRLSGIARGAWLYARNPLHLKDI
FITPDLDEAYRDGSLNVVAQVSRNSGTVELELKDKAGNIVEKTSVKPDGKGIVRTEMAVK
NPAKWSAEEPNLYTLLLTLKNNAGKVLEVVPQRVGFRKIELKKELGQVWVNGQPVLFKGA
DRHELDPLTGYQVSRERMIEDIRVMKENNLNAVRTCHYPDDPEWYNLCDEYGLYVVCEAN
IESHGMGYGERTLAKEPAYAKAHLERNQRMVETFKNHPSIIFWSLGNEAGDGPNFVACYD
WIKQRDGSRPVQYEQAGRRAHTDIVCPMYADLNWMENFAKSGDSRPLIQCEYAHAMGNSL
GGFKEYWDLIRKYPNLQGGFIWDFVDQGLRKYTADGAMIYAYGGDYNRYDASDKNFNCNG
LISPDRVPNPHMYEVRKMYQSIWTTPAALRKGIVNVYNENFFTDLSDYYLEWQLLQNGEP
VRQGVVMDLQIAPQQTQSVVLGYKETDLPAEGEILLNVTYRLKQARQLLPAGYAVAEEQL
EIAPYPLFQVELAETGQKASLYEDLVHAVVSAGEVQVTFGKWSGWIEGISLNGYEMIEYG
YALRPNFWRAPTDNDFGANLHRRFVDWKNPGLKLKSFKAEEQGNRVQVVTTYELPRLAAV
LTMTYLIGGNGEIRISEQLAVDKEKKDMPHLFRFGMQLVMPGRFDRIDYYGRGPVENYDD
RNESQRLGRYRQLVKDQYYPYIRPQESGTKSDIRWWKLTDIDGRGLAIRSDVPFSASALN
YLPEDLDDGWDKDQRHSGELKPRGLTTLSFDLKQMGLGCINSWGAWPLQPYLLPYQDYTF
QVVITPIRKY
NT seq 3093 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaactgttattgtgtctaggcttatgcctttctatgacaacgtttgctcaaaag
aaggaatggctcgatccggagttgaatgcgatcaaccgtgcaccggcaagggcggattat
tttgcttatccttccagggaaatggctgagcaaggagtaagagaagaatcatccaatttt
ctatcgttgaacgggatgtggaagtttaactgggtaaaggatcaaaccgaacggcctgta
aacttttatcggttggatttcgaggatcaatattgggtggacttcccggtgcccggaatc
tgggaaatgaatggatacggagatcccttataccgtaattcgggttatgcctggtcgaat
cagtttacacctgatcctccgaaaatagaaacggtgaataatcatgtgggctcttatcga
aaaaccgttgaaattcctgcttcatggaaaggacagcaggtgtttctgcatgtaggctct
gccacttcgaacttatatgtatgggtgaatggaaaatttgtcggttatagcgaagatagt
aagctggcagccgaattcgatataaccggttatgtacggccgggaaagaacctgatcgcg
atgcaggtatatcgttggtgtgacgggagttatcttgaagatcaggacttttggcgttta
tccggaattgcccggggagcttggttgtatgcccggaatccgttacatctgaaggatatt
tttatcactcccgatttggatgaggcgtatcgtgacggatctttgaatgtcgtggcccaa
gtgtcccggaacagcgggacagtggaactcgaattgaaagataaagcaggaaatatcgta
gaaaaaacgagtgtcaagcccgatggaaaaggaattgtgcgtaccgaaatggctgtgaaa
aatccggcaaaatggagtgctgaagagcctaatctgtatactttgttgctgactttaaaa
aataatgccggaaaagtgctggaagttgttccgcaacgggtcggattccggaaaatcgaa
ctgaagaaagaattggggcaggtatgggtcaatgggcagccggtcttgtttaaaggagcc
gaccgccatgaattggatcctttgaccggatatcaggtatcccgggagagaatgatcgag
gatatacgggtgatgaaggagaataatctgaatgccgtgcggacgtgtcattatccggac
gatcccgaatggtataacctttgtgacgaatatgggttgtatgtcgtgtgtgaagccaat
atcgaatctcatggaatggggtatggcgaacggacactggccaaggaaccggcttatgcc
aaggctcacctcgaaagaaatcagcggatggtggagacttttaaaaatcatccttcgatt
attttctggtcgttgggaaatgaagccggtgacggaccgaactttgtggcttgttacgac
tggatcaaacagagagatggcagccgtcctgtacaatatgaacaggcaggacgcagagcc
catacggatattgtttgtccgatgtatgccgacctgaattggatggaaaatttcgctaag
agtggggattcacgaccactgattcagtgtgaatatgcgcatgccatgggaaattctttg
ggcggttttaaagaatattgggatttgatccggaaatacccgaatttgcagggcggtttt
atctgggattttgtagatcagggacttcggaagtatacggcagacggcgcaatgatttat
gcttacgggggagattacaaccgctacgatgcttcggataagaattttaactgcaacggt
ttgatcagtccggaccgggtgccgaatccccatatgtatgaagtgcggaaaatgtatcag
tcgatatggactacaccggcagctcttaggaaaggaatcgtaaatgtgtataatgagaat
ttctttaccgatctttcggactattacctggagtggcaattgttgcagaatggagagccg
gtgagacagggggttgtgatggatttgcagatcgccccgcaacagacacaatcggtcgta
ttggggtataaagaaacggatcttcctgctgaaggtgaaattctgctgaatgtgacctat
cgcctgaaacaagcccggcaattacttccggcaggttatgcggttgcggaagaacaattg
gagattgccccttatcctttgtttcaggttgaattggccgaaaccgggcaaaaggcttct
ctgtatgaagatttggtacatgctgtcgtgagtgccggagaagtacaggtgacttttgga
aaatggtccggttggatagaggggatcagtctgaatgggtatgagatgatcgaatatgga
tatgctttacggcccaatttctggcgggctccgacagataatgatttcggggcgaatctt
caccgccgctttgtggattggaagaatcccggattgaaattgaagagctttaaggcagag
gaacaaggcaatcgggttcaggtggtgaccacttatgaattaccccgattggcagctgta
ttgaccatgacttatcttatcggtggaaatggggagattcggatcagtgaacagcttgct
gtcgacaaggagaagaaagatatgccccacctgttccgtttcggtatgcaactggtgatg
ccgggcagattcgaccggatcgattattatggccggggacctgttgagaattatgacgac
cggaatgagagtcagcgtttgggccgttaccgtcagttggtgaaagatcagtattatcct
tatatccgtccgcaggaatccggtacgaaatcggatatccgttggtggaaactgaccgat
atcgatggacgtggtttggctattcgttcggatgttcctttctcagcctctgctttgaat
tatttaccggaagacctggatgacggttgggacaaagatcagcggcattccggagaattg
aaaccacgtggattgaccaccttgtcttttgacctgaaacaaatgggattgggatgtatc
aatagctggggtgcctggccgttacaaccttatctgttgccttatcaggactatactttc
caggtggtgattacgccgattcggaaatactga

DBGET integrated database retrieval system