KEGG   Odoribacter splanchnicus: Odosp_3230Help
Entry
Odosp_3230        CDS       T01428                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
osp  Odoribacter splanchnicus
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:osp00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Odosp_3230
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Odosp_3230
Enzymes [BR:osp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Odosp_3230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3839837..3840745
Genome map
AA seq 302 aa AA seqDB search
MNTHSLVSIEDYSKEEILEVLKLASEFEANPNQRLLEGKVVASLFFEPSTRTRLSFETAI
NRLGGRIIGFTDASSSSVTKGETLKDTIKMVDNYADLIVMRHPVEGAARYASEVAVHPVV
NAGDGANQHPSQTMLDLYSIYKTQGTLENLDICMVGDLKYGRTVHSLLQAMSHFHPTFHF
VAPESLQMPEAYKLHLKALNIPYYEHTELDEVIGKADILYMTRVQRERFADPLEYEKVKN
VYILRNAMLANAKENMRILHPLPRVNEIDVDVDENPKAYYFEQARNGVFARQAIISKALG
LK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaacacacacagcttagtatccatcgaagattacagcaaagaagagattctggaagta
ctgaaactggcttctgaattcgaagccaatccgaatcagcgtttattggaaggtaaagta
gtggcttccttattttttgaaccttctacccgtacccggttgagtttcgagactgcgatc
aaccgtttgggggggcgtattatcggttttacagatgcttcttcttcgagtgtcaccaag
ggagagactctgaaggatacgatcaagatggtagataattatgctgacttgatcgtgatg
cggcatccggtagaaggggctgctagatatgccagtgaagttgcggttcatcctgtggta
aatgccggagacggagcaaaccaacatccttcgcaaacaatgctcgatctttattctatt
tacaaaactcaggggactttggaaaatttggatatttgtatggtcggggatttgaaatac
ggacggacggtacattctttattacaagctatgagtcatttccatccgacgttccatttt
gtcgctcctgaatccttgcagatgccggaagcttataaactgcatttaaaagcattgaat
atcccttattatgaacataccgaactggacgaagtgatcggtaaagccgatattctgtat
atgacccgtgtacaacgggaacgattcgccgatccattggagtacgaaaaagtaaaaaat
gtgtatatcctgagaaatgccatgttggctaatgcaaaagagaatatgcgtatcctgcat
ccgctgcctcgtgtaaatgagatcgatgtcgatgtggatgaaaatccgaaagcttattac
ttcgaacaagcccgtaacggtgtgtttgcacggcaggctattatttccaaggctttggga
ttgaaataa

DBGET integrated database retrieval system