KEGG   Odoribacter splanchnicus: Odosp_3249Help
Entry
Odosp_3249        CDS       T01428                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
osp  Odoribacter splanchnicus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:osp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Odosp_3249
   01230 Biosynthesis of amino acids
    Odosp_3249
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Odosp_3249
   00030 Pentose phosphate pathway
    Odosp_3249
   00051 Fructose and mannose metabolism
    Odosp_3249
   00052 Galactose metabolism
    Odosp_3249
  Energy metabolism
   00680 Methane metabolism
    Odosp_3249
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Odosp_3249
Enzymes [BR:osp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Odosp_3249
Protein phosphatases and associated proteins [BR:osp01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Odosp_3249
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3863025..3864212)
Genome map
AA seq 395 aa AA seqDB search
MNQKAKGIIGILTGGGDVPGLNPAIRAVTIRALREGYKVIGIRRGWKGLVDVIRDKKVDN
SCNYFELTEEIVNKAGRTGGTFLHSSRTRASHVPQSAVPEHLKDKYNAEINDLTPEVLKN
LEFIGIDYLIPIGGDDTLSYAVRLSQEGVKVVAIPKTMDNDVPGTDYCIGFSTCITRTIE
LTHDLRTCAGSHERLLVLEVFGRYAGFSAMLPTLAGAANRCVIPEYQFDIERLAELLCQD
RYTNPSKYSVVLVSEGASYSGGQMMFQSDEADMFGHKKLGGIGDYVSNELKNLSPKFNKG
ETINVINQKLGYLVRCGNPDAMDSIVPMAYGNLALDLISKGMHGRLVILRNGRYDNAPID
IVTSSKKLVDINKFYNTDRLRPQYNSFEFMPQMIL
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaatcagaaagcaaaaggaattatcggtattttaaccggaggaggagatgtaccagga
ttgaatcccgccatcagagcagtcaccatacgtgccttacgagaagggtataaagtgatc
ggaatccggcggggctggaagggtttggtcgatgtcatccgggacaaaaaagtagataat
tcatgtaattatttcgagttgaccgaagaaatcgtaaataaagcaggacgaacaggaggt
acttttttacattcatcccggacacgtgcttcgcatgtcccccaatcagccgttcccgaa
catctgaaggacaaatacaatgcagaaataaacgatttaacccctgaagtcctgaagaat
ctggaatttatcggcatcgactacctcatcccaatcggaggagacgacaccttaagctat
gccgtacgcctgagtcaggaaggagtaaaagtagtagcgatcccgaaaacgatggataac
gatgtaccgggtacggactattgtatcggtttcagtacctgtatcacccggacgatcgag
ctgacccatgacttgcgaacttgcgccggttcacacgaacggctgctggtactggaagtc
ttcggacgctatgccggtttctcagccatgttaccgacactggcaggagcagcaaaccgc
tgtgtgattcccgaataccaattcgatatcgaacggttagcggaattattatgccaggac
cggtataccaatccgagcaagtattcagtggtactggtatccgagggagctagttacagc
ggcggccagatgatgttccaaagtgatgaagcggacatgttcggtcataagaaattagga
ggaattggagattatgtttccaacgagcttaaaaatctttctccgaagttcaataaaggg
gaaaccatcaatgtcatcaatcaaaaacttggttatctggtacgttgtggaaatccggat
gcgatggactctatcgtgcctatggcttatggtaatcttgcactcgatttaatctctaaa
ggaatgcacgggcgtttagtcattttaagaaacggacgttatgataatgcacctatagat
attgtcaccagtagtaaaaaattggtcgatatcaataaattctataataccgatcgtctg
cgtcctcaatacaatagcttcgaatttatgccgcaaatgattctttaa

DBGET integrated database retrieval system