KEGG   Ostreococcus tauri: Ot01g01830Help
Entry
Ot01g01830        CDS       T01358                                 

Definition
clathrin heavy chain, putative (ISS)
Orthology
K04646  
clathrin heavy chain
Organism
ota  Ostreococcus tauri
Pathway
Endocytosis
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:ota04144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BOGAS: 
UniProt: 
Position
1
AA seq 1584 aa AA seqDB search
MEPVVFWKWITPTMLGIVTNTSVFHWSIEDQNAPVKVFDRTANLSGSQIISYKASEDMQW
FTLIGIAQGDASRPALVKGNMQLYSVAQQRSQALEAHMASFATHQVPGNAKKSQLVVFAQ
KMVQADGSIASKLHVIELGAPAGQTPFTKRSSELFFPPEFADDFPVVMHASDKYGVVYIV
TKSGLLFVYDLETASPVYRTRISQEPVFIGAAAPSVGGLYIVNRGGQVLLATLNEAAVVP
FVSGQLNNLELALSLASRGNLPGADALVMPKFDMLFNAADYKGAAELAASMSTLRNEQTI
ARFRNVPTQPGQSSPLLQYFGACLQRGNLNKLESVELAKLVLAQNKKQLLDTWLSEDKLE
ASEELGDLISPTDSETALKIYVKARANPKVTAAFAGRGEFDKMAQYCAAVGYKPDYMYML
QSLMMSNPPGAVQLAQQMSQMTPPPVDMGNIADLFLQRNMIREATSILLDLLKEDDPEQA
SLQTKVLEINLVTYPNVADAIMAQGKLTHYDKPRIAQLCEKAGLYVRAMEHYSELVDLKR
CVVNTHSMDPQALTEFFGTLSREWALECLQELLKINIRQNLQIAVNIAKEYTEQLEIQSV
VKMFDKFESHEGLFYYLGYFVNTCEDKEVVYKFIEAASKIGQIKEVERVTRESDHYDPER
VKVFLMEAKLADARPLINVCDRHEFVGDLTTYLYNNNMLRYIEGYVQKVNPKQAPKVVGT
LLDLECPDDFIKTLILSVRSLLPVAPLVEEVEKRNRLKILTQFLEHLVNEGSIDPQVHNA
MGKMLIDSNQNPEHFLLTNEYYESAVVGRYCERRDPYLACVAYKRGKCDDELVDCTNRNS
MFKVQARYVVERMEPELWAKVLTNDNKFCRQFIDQVVSTALPESKNPEQVSVTVKAFMTA
EMPHELIELLEKIVLQNSAFSNNPNLQNLLILTAIKADATRVMDYVNRLDAFNGPEVAEI
AAGNELYEEAFAIYKKFDLHVDAMKILLESLEDIERGIEYARKVELPEVWYQLGKAQLKM
GTPEAVKEAIKSYIKAQDGSDFIDVIHAARHADMYVDMVPYLLMVRKTKKEARIDTELVY
AYAKINDLARLEDFLTSPNSANQQSVADRCFSEGLYEAARLLFTALSNWACLTSTLLKLR
MFQSAVDAAKKANSPKTWKEVCFTCVDEGENKLAQLAGLHIVIQADELDSVSEFYQARGK
FTELIALMEAGVGVDRAHMGIFTELGILYANHASEKLMEHIRLFSARINIPRLITTCTNV
ALWPELAYLYRCYDEYDNACEVMMEHPDAWEHVVFKDVCVKLANADLYYKAIKFYIREHP
TEMTNLLGVLQSRLDHSRVVALMRKEGKLPMVKEYLLSVQGANLTAVNDAVNELAIEEED
HVALKASIDMYDNCDQLSLAIQCESHELIEFRRISSYIYQRNSRWKQAIELSKRDGLLKD
AMEIAAKSNDSSIVDELLEFFIETGNKECFSAALCTCYDLLKPDEVMQKAWLHGLSDWVM
PFMIQVMRDMNSKIDILMKDKADRNEEKVNEEKERVAAEMNSNLYAQLMPAALPAYEGQG
AGGYAPQQGFAQQYAYPPQQQQGW
NT seq 4755 nt NT seq  +upstreamnt  +downstreamnt
atggaaccggttgtgttctggaagtggatcacgccgacgatgctggggattgtgaccaac
acctctgtgtttcactggtcgatcgaagatcagaacgcaccggtgaaggtgttcgataga
acggcgaacctgagcgggagccagatcatcagttacaaggcatcggaggacatgcagtgg
ttcaccttgattggcatcgcgcagggcgatgcgtcgagaccggcgttggtcaagggtaac
atgcagctgtattccgtcgcgcaacagcgctcgcaggcgctcgaggcgcacatggcctcg
ttcgcgacacaccaggtgccgggcaacgcgaaaaagagccagttggtggttttcgcacaa
aagatggttcaagccgacggatctattgcgtccaaactgcacgtcatcgagcttggcgct
ccggcaggacaaacacccttcacgaaacgctcgagcgagctgttcttccctccagaattt
gctgacgacttccctgtcgtcatgcacgcaagcgacaagtacggcgtcgtgtacatcgtc
accaagagcggtttgctgttcgtgtacgatttggaaacggcatcgccggtgtatcgtacg
cgcatttcgcaagagcccgtcttcatcggtgccgcggcgccgagcgttggtggcttgtac
atcgtgaatagaggtggacaagtcctgttggcaactctgaacgaagccgccgttgttcca
ttcgtcagcggtcaactcaacaacttagagctcgcgctttctctagcatcgcggggtaac
ctccccggtgccgatgcgctcgttatgcctaagtttgacatgctcttcaacgccgctgac
tacaagggtgcagccgagctcgccgcgagcatgagcaccttgagaaatgaacaaacaatc
gcgcgcttccgcaacgtgccgacgcaaccaggtcaaagctcgccgctgctccaatacttt
ggtgcgtgcttgcaacgcggcaatttgaacaagttagagtccgttgaacttgccaagctt
gtgctcgcgcagaacaagaagcaacttctcgatacctggctcagcgaagacaagctcgaa
gcgagcgaggagctcggcgatttgatctctccgacggactctgagaccgcgctcaagatt
tatgtcaaggcgcgcgcaaacccgaaagtcaccgcggcgttcgcgggacggggtgagttc
gataagatggcgcaatattgcgccgcggtcggttacaaacccgactacatgtacatgctg
cagtctttgatgatgagcaacccgccaggtgcggtgcaactcgctcagcaaatgagtcag
atgacgccgccgccggtcgatatgggtaacatcgcagacttgttcttgcaacgcaatatg
atccgcgaggccacgtcgatcctgctcgatttgctcaaggaggatgatccggagcaggcg
tcgcttcagacaaaggtactcgaaatcaacttggtcacatatccgaacgtggctgacgca
atcatggcgcaaggcaagctcacgcattacgataagccacgcatcgcgcagctctgcgaa
aaggctggcctttacgttcgtgcgatggagcactattcagagttagtggatttgaagcga
tgcgttgtgaacacgcactccatggatcctcaggcgctgactgagttttttggaacgttg
agccgcgagtgggctcttgagtgcctccaagagctcctgaagatcaacatacgccaaaac
ctgcaaatcgcggtaaatatcgccaaggaatataccgaacaactcgaaatacaatcggtc
gtgaagatgtttgacaagttcgaatctcatgaaggtttgttctactatctcggctacttc
gtcaacacgtgcgaggataaggaagtggtgtacaagttcatcgaagcggcgtccaagatt
ggccaaattaaggaagttgagcgcgttacgcgcgaaagcgatcactatgatccagagcgt
gttaaggttttcctcatggaggctaagcttgcggacgccaggccgctcatcaacgtctgc
gatcgacacgagttcgtgggcgatttgacgacctacctttacaacaacaacatgctgcgt
tatatcgaaggctacgtacaaaaggtgaacccgaagcaggcgccgaaggttgttggtacg
ctcttggatctcgagtgcccggatgacttcatcaagacgctcattctctccgtgcgttcc
ttgttgccggtggcgcctctcgtcgaagaggtcgaaaaacgcaacagactcaagattctg
acgcaattcctcgagcacttggtgaacgagggaagcattgatccgcaagtccacaacgcc
atgggtaagatgctgatcgacagcaatcaaaacccggagcacttcttgcttactaatgag
tactatgagtctgccgtcgttggccgatactgcgaacgccgcgacccatacttggcttgt
gtcgcgtacaagcgaggcaagtgtgatgacgagctggttgattgcacgaacagaaacagc
atgttcaaggtgcaagcgagatacgtcgtcgagcgcatggagcccgagctttgggcgaag
gtgttgacgaatgataacaagttctgccgccaatttatcgaccaagtggtgtccacagcg
ctgccagagagcaagaatcccgagcaagtgtccgtcactgtcaaggctttcatgacggct
gagatgccgcatgagctcatcgagttattggagaagattgtgctgcaaaacagcgcgttc
agcaacaacccgaacttgcagaacttgctcatcctcaccgccatcaaggcagatgctacg
cgcgtgatggactacgtcaaccgcctcgacgccttcaacgggcctgaggtcgcggaaatc
gccgcgggtaacgaactctacgaagaggcgtttgccatctacaagaagttcgatcttcac
gtcgatgcaatgaagattcttctcgagtctctcgaagacattgaacgaggcattgagtac
gctcgcaaggttgagctcccagaggtgtggtaccagctcggcaaggcgcagctcaagatg
ggcacgccggaagcggtcaaggaagccatcaagtcatacattaaagcacaagatggcagc
gacttcatcgacgtcatccatgcggcacgacatgcggatatgtacgtagacatggttccg
tatttgctcatggttcgcaagacgaagaaggaagcgcgcatcgacacggagcttgtctat
gcgtacgcgaagatcaacgacttggccaggctcgaggattttctcacctccccaaacagt
gccaaccaacaatcggtggctgatagatgcttctccgaaggtctgtatgaagccgcgcgt
ctgctattcacagcgctcagcaattgggcctgcctgacgagcactttgctcaaacttcgc
atgttccaaagtgcggtcgacgctgctaagaaagcgaattctccaaagacgtggaaggaa
gtgtgtttcacgtgcgttgacgagggtgagaacaagctcgcgcagcttgcaggtcttcat
atcgtcatccaagccgatgagctcgactccgtcagtgagttttaccaggctcgaggtaag
ttcacagaactcatcgcgctcatggaagctggcgtcggtgttgacagagcgcacatgggt
atcttcaccgagctcggcattctttacgcgaaccacgcgtctgagaagctcatggagcac
atccgtttgttcagcgcgcgtatcaacattccgcgtctcatcacaacctgcaccaacgtt
gccttgtggccggaactcgcgtacctgtacagatgctacgacgagtatgataacgcctgt
gaagtgatgatggagcatccggacgcgtgggagcacgtcgtcttcaaggatgtgtgcgtc
aaactcgcgaacgcagacttgtactacaaggcgatcaagttctacattcgcgagcacccg
acagagatgaccaaccttctaggcgtacttcagtctagactcgatcactctcgagtggtg
gcgttgatgcgtaaggaaggcaagttacccatggtgaaggagtatctgttgtcggttcaa
ggcgccaatttgactgcggtgaacgacgcggtgaatgagcttgcaattgaggaagaggac
catgtcgcgctcaaggcgtcgatcgacatgtacgataactgcgatcaactctcgctcgcg
attcagtgcgaatcacacgagctgatcgagtttcgaagaatttcttcgtacatttaccaa
cgtaactctcgatggaagcaagccatcgagcttagcaagcgcgacggtttgctcaaggat
gcgatggaaatcgccgcaaagagcaacgactcaagcatcgtcgacgagcttctcgagttc
ttcatcgagacgggcaacaaagagtgcttctctgccgccctatgcacgtgctacgacttg
ttgaagccggacgaggtcatgcaaaaggcgtggttgcacggccttagcgattgggtgatg
ccgttcatgattcaagtcatgcgagacatgaactcaaagattgacatcttgatgaaggac
aaggcggatcgcaacgaggagaaagtgaacgaggagaaggaacgtgtcgctgcggagatg
aatagcaacctatacgcgcagctcatgcctgcggcgttgcctgcgtatgaaggccaaggt
gcgggcgggtacgctccccaacaaggcttcgcccaacagtatgcctacccgccacaacag
cagcaagggtggtaa

DBGET integrated database retrieval system