KEGG   Ostreococcus tauri: Ot01g03240Help
Entry
Ot01g03240        CDS       T01358                                 

Definition
acetyl-CoA carboxylase (ISS)
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
ota  Ostreococcus tauri
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:ota00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Ot01g03240
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Ot01g03240
   00640 Propanoate metabolism
    Ot01g03240
  Lipid metabolism
   00061 Fatty acid biosynthesis
    Ot01g03240
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    Ot01g03240
Enzymes [BR:ota01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     Ot01g03240
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     Ot01g03240
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BOGAS: 
Position
1
AA seq 2123 aa AA seqDB search
MQIAMPTTTASAAAHAVSIRSSKNKVLGDVRRGISARASVRRADSTRRIAVARATNRDVH
VVRAIADSSPSTSELSSADALAKYVAERGGKRVIRKVLIANNGMAAAKSILSMRRWAFNE
FGDENAIQFLAMATPEDLGANAEFIRYADDYVEVPGGSNKNNYANVPLITEIAKREGVDA
VWPGWGHASENPKLPTALKAIGVQFIGPTAPVMSVLGDKIAANILAQTAKVPSIPWSGDG
LVAELTAEGTIPEETFNKAMVTTVEECVAAAKRIGFPVMLKASEGGGGKGIRMSADEEQL
RVNFEQVKAEVPGSPMFMMQLCTQARHLEVQIVGDEYGNAIALNGRDCSTQRRFQKIFEE
GPPTVAKKDVFREMEKAAQRLTKNIGYIGAGTVEYLYNAETDKYFFLELNPRLQVEHPVT
EGITGVNLPATQLQVAMGIPLSRIPEIRRFYGRDIDSTDDIDFMEEDYKYPETHVIAARI
TAENPDEGFKPTSGGIERISFQSTPNVWGYFSVGANGGVHEFADSQFGHIFASGRNRNEA
RKALILALKGMVVRGEIRTAVEYLVQLLETDEFKANTIDTSWLDGLIAKKQIANKQDEHM
IVLGAAIFRAFNMAKTEEAAFTEFWQKGQVSVQGVDKMIRFPIEITYNDVKYSFQITRPG
PDIFLVSTPEGQSIEAKIRERADGALVAIFGGEQHEIEGLEEPLGLRMILDGQTWLLPTV
FDASELRTDVTGKLIRFLQDDGAEVVAGKPYAEVEAMKMVMPLVATESGKINHAKAAGAV
IEAGDLLASLTLKDPSKVKKITTHSGALRLPVCDEAPPGPEEALNAAIGRVNLFLDGYEL
DANQCVSDLLSSLTSLPADQGRWERATDVLDQIIQRYLSVESVFEGKKLDAVMQQLIRAN
SSNLQPVLDQVRSHMRSKERQGLILSLLKQAPTLPQRVMSRGPISWADDHAPISDSLRKN
IERLSKLRGGEYGDIAVQASNILLERRLPSIDKRLDELKKILLGSQPLLRSWSIGGKAPL
PGDLQSLVESPTLAVDLLPSLFSDKDEKVQNAALEVYCKRVYRAHNVLSTSVSRDNGMTS
ISWNFKFNTFPDESPLRCGMLARVDTVADAKQNFSAMLDRLESNVKAAGAGGSSDTQLHV
LHVAVCKQSADDGLPTDLEAFIASHKDRLNAMGIKFVNFLAYSDLELPAYFTFHSGKDFK
EDMLYRGERPTVAHLLELARLENFKLTRLPTVNRDLHMYVGETSANVGKRGPAKHLLLRR
LSHSKDMMDGGLERVLGKALEAVSLSLVDSRAKGVSSSRLYVNFLPVFEDLNFNTAVATM
KSKLTDYISRESAQLLAKKVDEIEVRFRVGKEKVPLRLMATSMSGQWLKVDLYKEYLEST
SGKAEQFCLLGPNGEEESCFLEPYPQPGALAQKRAVARAIGTTYIFDFLGLFEKALVLDW
RTHIADVGGTMPSDFFSASELVLGNDGQLTKEQRPAGSNNVGMVGWHCFMKTPEYPEGRE
VVIVGNDCTYMSGSFGVKEDDVYDAISKYARKLGLPRVYIASNSGARIGLVEELKPYFKV
AWTDASNPGLGYKYLYLTPEDYKSFPEGTVKAEEVKEDGEIRMKLTDIIGQIHGIGVENL
RGSGMIAGEQSAAYADAFTLSYITGRSVGIGAYLCRLGQRNIQMTNGPLILTGYLALNKL
LGREVYTSQDQLGGPQVMMPNGVSHLQVADDQEGVRSILNWLSYTPATSKSQVRARRSSD
PVDRDIDFMPSKTPYDPRNMLAGVEQNGSFAKGFFDTDSWTETLPDWGKSVVTGRARLGG
VPCGVIAVETRMMEQRIPADPANPESREAVLAQAGQVWFPDSAHKTATAIRDFNNAENLP
LFIFANWRGFSGGTRDMYGEILKFGAMIVDELRVYRHPVFIYIPPNGELRGGAWVVVDPT
INEGRMEMYADVESRGGILEPPGICEVKFRPKDQLAAMHRLDPVLMELDKDAEANKDEIK
KREQNLLPMYTQVAHEFADLHDRSGRMKAKGVIRDVVEWKNARRYFHGRLTRRLAVDALA
SKIKSELGDIKLDRPVEEYIEEAVAASGVNANDDNAVAAMLESNSAKIGNDVMIKGRAAK
VAQYVEKLKGLDAEDLKAILAQM
NT seq 6372 nt NT seq  +upstreamnt  +downstreamnt
atgcagatcgctatgccgacgacgacggcgagcgccgcggctcatgcggtgtcgatacga
tcgtcgaaaaataaagttttgggcgatgtgcgacggggaatctcggctcgagcgtcagtg
cgtcgagcagattcgacgcgacgcatcgcggtggcgcgcgcgacgaaccgtgacgtgcac
gtggtgcgcgcgatcgcggattcatcaccaagcacgtcggagctatccagcgcggatgcc
ctggcgaagtatgtcgctgaacgaggaggtaagcgcgtgatccgcaaggtcttaattgcg
aacaatggcatggcggcggcgaagagcattctgtcgatgcgtcgctgggcgttcaacgag
ttcggcgacgagaacgcgatccagttcttggccatggcgacgccggaagatctcggggcg
aacgccgagttcattcgttacgccgatgactacgtggaagtgcctggtgggtcaaacaag
aacaactacgcaaatgtaccgctcatcacggaaatcgccaagcgcgagggcgtggatgcg
gtgtggccgggttggggtcacgcctcagagaatccgaagctcccgacggcgctcaaggcc
atcggcgtgcagttcatcggtccgactgcgccggtgatgagcgtgctgggtgacaagatc
gcagctaatattttggcgcaaacagccaaggtgccatcgatcccgtggtccggcgacggc
ctcgtcgccgagttgactgcagagggcaccattcccgaagagacgttcaacaaggcgatg
gtcaccacggtggaggagtgcgtggccgcggcgaaaagaattggcttcccggtcatgtta
aaggcgtccgaaggtggtggcggtaagggtatccgtatgagcgcggacgaagagcagctt
cgggtgaactttgagcaagtcaaggctgaagttccgggctctccgatgttcatgatgcag
ctttgtacacaagctcgtcacttggaggttcagattgtgggcgatgagtacggtaacgcg
atcgcgctaaatggacgtgattgctccacgcagcgtcgtttccaaaagatctttgaggaa
ggccctccaacggtggcaaagaaggatgtcttccgtgaaatggagaaggcggcacaacgt
ctgacgaagaacatcggctacatcggtgcaggcactgtcgagtacctctacaacgccgag
actgataagtatttcttcctcgagctcaacccgcgtttgcaagtcgagcacccggtgact
gaaggtatcacaggcgtgaaccttccggccacacagctgcaagttgccatgggtattcca
ctctcacgcatccctgaaatccgacgcttctacggcagagatattgacagtactgacgat
atcgatttcatggaagaggattacaagtaccccgagacacatgttattgctgctcgcatc
actgccgagaacccagacgaaggcttcaagccgacgtctggtggaatcgagcgcatctcc
ttccagtccacaccaaacgtgtggggttacttctccgtcggtgccaacggtggtgttcac
gagttcgccgattctcagtttggtcacattttcgcctcagggcgcaaccgtaacgaagcg
cgaaaggctctcattcttgctttgaaggggatggtcgtgagaggtgaaattcgcaccgct
gtcgaatatttggttcaacttctcgaaacggatgagttcaaggcgaacaccatcgacacg
tcttggttggatgggctgatcgcgaagaagcaaatcgcgaacaagcaagatgaacacatg
atcgttctcggcgcggctatcttccgagctttcaatatggctaagacagaagaggctgcg
ttcacggagttctggcagaagggccaagtctccgtccaaggtgtagacaagatgattcga
ttcccgatcgaaatcacgtacaatgacgtgaagtacagcttccaaatcactcgacccggt
cctgacatattcctggtgagcactccggaaggccaatcgatcgaggcaaagatccgtgag
cgtgctgacggcgccctcgttgccatttttggtggcgagcaacacgagatcgaaggtttg
gaggagccgcttggcttgagaatgattcttgacggccaaacgtggttgttgccgaccgtc
tttgatgcgtccgaacttcgcaccgacgttacaggtaagctcattcgcttcctgcaagat
gatggagctgaggtggtggctggcaagccgtacgctgaggttgaagcgatgaagatggtt
atgccgcttgttgccaccgagagcggtaagattaaccacgccaaggctgcgggtgctgtt
atcgaagccggtgacttgctcgcctcgctcacactcaaggatccaagcaaggtgaagaag
atcaccacgcacagtggcgcgcttcgcctgccagtctgtgacgaggctccgccaggccca
gaggaagctcttaacgccgccatcggccgggtcaacctctttctggacggctatgagctt
gacgctaatcaatgcgtctccgacctcctcagctctctcacgtcgctcccggcggatcaa
ggtcgctgggaacgcgcaacggatgtccttgatcaaatcattcagcgctatctcagcgtc
gaaagcgtgttcgaaggcaagaagttggacgctgtcatgcagcaactcatccgcgcgaac
agcagtaacttgcagccggttttagatcaagttcgatcgcacatgcgctcgaaggaacgg
caaggtctcatcttgagcctgctcaagcaggcgccgacgctgccgcagcgcgtcatgtct
cgaggtcccatttcgtgggcggacgatcacgctccgatctctgactccttgcgcaagaac
atcgaacgtctctccaagcttcgaggcggtgagtacggcgatatcgctgttcaagcctca
aacatattgcttgagcgcaggttaccgtcaatcgacaagcgtttggatgagttgaagaag
attctcctcggatctcagccgttgttgcgctcttggagcatcggtggcaaggccccgctg
cccggagatctccaatctctggttgagtcgccgacgttggcagtcgatttgttgccgtct
ctcttctctgataaggacgaaaaggtgcagaacgctgctctcgaggtgtactgcaagcgc
gtctaccgagctcacaatgtcctcagcacctcggtctctcgtgacaatggcatgacctcc
atcagctggaacttcaagttcaacacgttcccggatgagagcccgcttcgatgcggtatg
ctggctcgtgtggataccgttgcggacgccaagcaaaacttctccgccatgttggatcga
ctcgagtcaaacgtcaaggcggcgggcgcgggtgggtccagcgacacccagctgcacgtt
ctccatgtggccgtttgcaagcaaagcgccgacgatggcttgcccactgatcttgaggca
ttcatcgcttctcacaaggatcgactgaacgcgatgggcatcaagttcgtcaacttcctt
gcgtattctgatctcgagttgccggcctacttcaccttccactccggtaaggacttcaag
gaagatatgctgtacagaggtgagcgacccactgtcgcccacttgcttgagttagctcgt
cttgaaaacttcaagctcactcgacttccgacagtaaaccgagacttgcacatgtatgtg
ggtgagacttcggcgaacgtcggcaagcgtggtccggcaaagcacctcttgcttcgtcgt
ctttcccactccaaggatatgatggacggaggcctcgaacgcgtgctcggtaaggctttg
gaagccgtgtcactctcgttggtagacagcagagccaaaggggtttcctcctccaggctg
tatgtcaacttcttgccagtgttcgaagatctcaacttcaacacggccgtagccacaatg
aagagcaagctgaccgactacatcagccgcgagtcagctcagcttctcgctaagaaggtc
gatgagattgaggttcgcttccgtgtgggcaaggagaaggttccgcttcgattgatggcg
acttcaatgtctggccagtggctcaaggtcgacctctacaaggagtacctcgagtcaacg
agtggcaaggctgaacagttctgcttgctcggcccgaacggagaggaagaatcttgcttc
cttgagccgtacccgcagccgggtgcgctcgcgcagaagcgtgccgttgcacgcgcgatt
ggcacgacttacatcttcgacttccttggtctctttgagaaggctcttgtccttgactgg
cgcacccacattgctgatgtcggagggacgatgccgtccgacttctttagcgcttcggag
cttgttctcggtaatgatgggcaactcacgaaggaacaacgcccggcgggttcgaacaac
gtcgggatggtcggctggcattgcttcatgaagactcccgagtaccctgaagggcgcgaa
gttgtcatcgtcggcaatgactgcacgtacatgtctggttccttcggtgtcaaggaagat
gacgtgtacgatgccatttcgaagtacgctcgtaagttgggcttgccgcgtgtgtacatc
gcgtccaactctggcgcgcgaatcggcctcgtcgaagagcttaagccgtacttcaaagtg
gcttggacagatgcgtccaacccgggcttgggctacaagtacctgtatctcacgccagaa
gactacaagtccttcccggagggtactgtcaaggcggaagaggtcaaggaggatggtgaa
attcgcatgaagctcacagatataattggccaaattcatggcattggtgttgaaaacttg
cgaggctctggtatgatagcgggcgagcagtccgcagcgtatgcggatgccttcactctc
tcgtacatcaccggtcgctctgtaggtatcggcgcgtacctgtgccgacttggccagcgt
aacatccaaatgacgaatggtcccctgatccttaccggttacttggcgctcaacaagctt
ctcgggcgcgaagtgtacacgagccaagatcagcttggtggcccacaagtcatgatgcca
aacggtgtctcgcacttgcaagtcgccgacgatcaagaaggtgtcagatccatcttgaac
tggctctcgtacacgcctgctacgtcgaagtctcaagtgcgcgctcgtcgttcgtctgat
ccggtcgatcgtgacatcgacttcatgccgtcgaagactccttacgacccgcgcaacatg
ctcgcaggtgtcgaacagaatggtagcttcgcgaagggtttcttcgacactgactcgtgg
accgagactttgcccgactggggtaagtccgtcgttaccgggcgagcccgactcggtggt
gtaccgtgcggtgtcatcgccgtcgaaacacggatgatggagcagcgaatccctgctgac
cctgcgaaccctgagtctcgcgaggccgtgttggctcaagcgggtcaggtgtggttcccg
gatagtgcgcacaagacggctacggcgattcgtgatttcaacaacgctgagaacttgcct
ctattcatcttcgccaactggcgtggattcagcggtggtactcgggatatgtacggcgag
atcttgaagttcggcgcgatgattgtcgacgagcttcgcgtctaccgccatcctgtcttc
atttacattccgccgaatggtgagctccgcggtggtgcctgggttgtcgttgatccgacc
atcaacgagggacgaatggagatgtacgcggacgtggaatctcgagggggcatcctcgag
ccgccgggcatctgtgaggtcaagttccggcccaaggaccaactcgccgcgatgcaccgc
ttggatccggttcttatggaattggacaaggacgctgaagcgaacaaggacgagatcaag
aagcgtgagcaaaacctgttgccgatgtacacgcaagtcgctcacgaattcgccgacctt
cacgatcgcagcggtcgtatgaaggcgaagggtgtgattcgtgacgtggtcgagtggaag
aatgcgcgccgttatttccatggcagactcacgcgcagacttgctgtcgatgccttagct
agcaagatcaagtctgaacttggtgacatcaagctcgacagacctgtcgaggaatacatc
gaggaggcggtcgccgcgtcaggcgtcaacgccaatgacgataacgccgtcgccgcgatg
ctcgagagcaactcggcgaagattgggaacgacgtcatgatcaagggtcgtgctgccaag
gttgcccaatacgttgaaaagttaaagggcctcgacgctgaggacctcaaagccatcctc
gcccagatgtag

DBGET integrated database retrieval system