KEGG   Ostreococcus tauri: Ot01g03240Help
Entry
Ot01g03240        CDS       T01358                                 

Definition
acetyl-CoA carboxylase (ISS)
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
ota  Ostreococcus tauri
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Class
Metabolism; Overview; Fatty acid metabolism [PATH:ota01212]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:ota00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:ota00640]
Metabolism; Lipid metabolism; Fatty acid biosynthesis [PATH:ota00061]
Metabolism; Biosynthesis of other secondary metabolites; Aflatoxin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BOGAS: 
UniProt: 
Position
1
AA seq 2123 aa AA seqDB search
MQIAMPTTTASAAAHAVSIRSSKNKVLGDVRRGISARASVRRADSTRRIAVARATNRDVH
VVRAIADSSPSTSELSSADALAKYVAERGGKRVIRKVLIANNGMAAAKSILSMRRWAFNE
FGDENAIQFLAMATPEDLGANAEFIRYADDYVEVPGGSNKNNYANVPLITEIAKREGVDA
VWPGWGHASENPKLPTALKAIGVQFIGPTAPVMSVLGDKIAANILAQTAKVPSIPWSGDG
LVAELTAEGTIPEETFNKAMVTTVEECVAAAKRIGFPVMLKASEGGGGKGIRMSADEEQL
RVNFEQVKAEVPGSPMFMMQLCTQARHLEVQIVGDEYGNAIALNGRDCSTQRRFQKIFEE
GPPTVAKKDVFREMEKAAQRLTKNIGYIGAGTVEYLYNAETDKYFFLELNPRLQVEHPVT
EGITGVNLPATQLQVAMGIPLSRIPEIRRFYGRDIDSTDDIDFMEEDYKYPETHVIAARI
TAENPDEGFKPTSGGIERISFQSTPNVWGYFSVGANGGVHEFADSQFGHIFASGRNRNEA
RKALILALKGMVVRGEIRTAVEYLVQLLETDEFKANTIDTSWLDGLIAKKQIANKQDEHM
IVLGAAIFRAFNMAKTEEAAFTEFWQKGQVSVQGVDKMIRFPIEITYNDVKYSFQITRPG
PDIFLVSTPEGQSIEAKIRERADGALVAIFGGEQHEIEGLEEPLGLRMILDGQTWLLPTV
FDASELRTDVTGKLIRFLQDDGAEVVAGKPYAEVEAMKMVMPLVATESGKINHAKAAGAV
IEAGDLLASLTLKDPSKVKKITTHSGALRLPVCDEAPPGPEEALNAAIGRVNLFLDGYEL
DANQCVSDLLSSLTSLPADQGRWERATDVLDQIIQRYLSVESVFEGKKLDAVMQQLIRAN
SSNLQPVLDQVRSHMRSKERQGLILSLLKQAPTLPQRVMSRGPISWADDHAPISDSLRKN
IERLSKLRGGEYGDIAVQASNILLERRLPSIDKRLDELKKILLGSQPLLRSWSIGGKAPL
PGDLQSLVESPTLAVDLLPSLFSDKDEKVQNAALEVYCKRVYRAHNVLSTSVSRDNGMTS
ISWNFKFNTFPDESPLRCGMLARVDTVADAKQNFSAMLDRLESNVKAAGAGGSSDTQLHV
LHVAVCKQSADDGLPTDLEAFIASHKDRLNAMGIKFVNFLAYSDLELPAYFTFHSGKDFK
EDMLYRGERPTVAHLLELARLENFKLTRLPTVNRDLHMYVGETSANVGKRGPAKHLLLRR
LSHSKDMMDGGLERVLGKALEAVSLSLVDSRAKGVSSSRLYVNFLPVFEDLNFNTAVATM
KSKLTDYISRESAQLLAKKVDEIEVRFRVGKEKVPLRLMATSMSGQWLKVDLYKEYLEST
SGKAEQFCLLGPNGEEESCFLEPYPQPGALAQKRAVARAIGTTYIFDFLGLFEKALVLDW
RTHIADVGGTMPSDFFSASELVLGNDGQLTKEQRPAGSNNVGMVGWHCFMKTPEYPEGRE
VVIVGNDCTYMSGSFGVKEDDVYDAISKYARKLGLPRVYIASNSGARIGLVEELKPYFKV
AWTDASNPGLGYKYLYLTPEDYKSFPEGTVKAEEVKEDGEIRMKLTDIIGQIHGIGVENL
RGSGMIAGEQSAAYADAFTLSYITGRSVGIGAYLCRLGQRNIQMTNGPLILTGYLALNKL
LGREVYTSQDQLGGPQVMMPNGVSHLQVADDQEGVRSILNWLSYTPATSKSQVRARRSSD
PVDRDIDFMPSKTPYDPRNMLAGVEQNGSFAKGFFDTDSWTETLPDWGKSVVTGRARLGG
VPCGVIAVETRMMEQRIPADPANPESREAVLAQAGQVWFPDSAHKTATAIRDFNNAENLP
LFIFANWRGFSGGTRDMYGEILKFGAMIVDELRVYRHPVFIYIPPNGELRGGAWVVVDPT
INEGRMEMYADVESRGGILEPPGICEVKFRPKDQLAAMHRLDPVLMELDKDAEANKDEIK
KREQNLLPMYTQVAHEFADLHDRSGRMKAKGVIRDVVEWKNARRYFHGRLTRRLAVDALA
SKIKSELGDIKLDRPVEEYIEEAVAASGVNANDDNAVAAMLESNSAKIGNDVMIKGRAAK
VAQYVEKLKGLDAEDLKAILAQM
NT seq 6372 nt NT seq  +upstreamnt  +downstreamnt
atgcagatcgctatgccgacgacgacggcgagcgccgcggctcatgcggtgtcgatacga
tcgtcgaaaaataaagttttgggcgatgtgcgacggggaatctcggctcgagcgtcagtg
cgtcgagcagattcgacgcgacgcatcgcggtggcgcgcgcgacgaaccgtgacgtgcac
gtggtgcgcgcgatcgcggattcatcaccaagcacgtcggagctatccagcgcggatgcc
ctggcgaagtatgtcgctgaacgaggaggtaagcgcgtgatccgcaaggtcttaattgcg
aacaatggcatggcggcggcgaagagcattctgtcgatgcgtcgctgggcgttcaacgag
ttcggcgacgagaacgcgatccagttcttggccatggcgacgccggaagatctcggggcg
aacgccgagttcattcgttacgccgatgactacgtggaagtgcctggtgggtcaaacaag
aacaactacgcaaatgtaccgctcatcacggaaatcgccaagcgcgagggcgtggatgcg
gtgtggccgggttggggtcacgcctcagagaatccgaagctcccgacggcgctcaaggcc
atcggcgtgcagttcatcggtccgactgcgccggtgatgagcgtgctgggtgacaagatc
gcagctaatattttggcgcaaacagccaaggtgccatcgatcccgtggtccggcgacggc
ctcgtcgccgagttgactgcagagggcaccattcccgaagagacgttcaacaaggcgatg
gtcaccacggtggaggagtgcgtggccgcggcgaaaagaattggcttcccggtcatgtta
aaggcgtccgaaggtggtggcggtaagggtatccgtatgagcgcggacgaagagcagctt
cgggtgaactttgagcaagtcaaggctgaagttccgggctctccgatgttcatgatgcag
ctttgtacacaagctcgtcacttggaggttcagattgtgggcgatgagtacggtaacgcg
atcgcgctaaatggacgtgattgctccacgcagcgtcgtttccaaaagatctttgaggaa
ggccctccaacggtggcaaagaaggatgtcttccgtgaaatggagaaggcggcacaacgt
ctgacgaagaacatcggctacatcggtgcaggcactgtcgagtacctctacaacgccgag
actgataagtatttcttcctcgagctcaacccgcgtttgcaagtcgagcacccggtgact
gaaggtatcacaggcgtgaaccttccggccacacagctgcaagttgccatgggtattcca
ctctcacgcatccctgaaatccgacgcttctacggcagagatattgacagtactgacgat
atcgatttcatggaagaggattacaagtaccccgagacacatgttattgctgctcgcatc
actgccgagaacccagacgaaggcttcaagccgacgtctggtggaatcgagcgcatctcc
ttccagtccacaccaaacgtgtggggttacttctccgtcggtgccaacggtggtgttcac
gagttcgccgattctcagtttggtcacattttcgcctcagggcgcaaccgtaacgaagcg
cgaaaggctctcattcttgctttgaaggggatggtcgtgagaggtgaaattcgcaccgct
gtcgaatatttggttcaacttctcgaaacggatgagttcaaggcgaacaccatcgacacg
tcttggttggatgggctgatcgcgaagaagcaaatcgcgaacaagcaagatgaacacatg
atcgttctcggcgcggctatcttccgagctttcaatatggctaagacagaagaggctgcg
ttcacggagttctggcagaagggccaagtctccgtccaaggtgtagacaagatgattcga
ttcccgatcgaaatcacgtacaatgacgtgaagtacagcttccaaatcactcgacccggt
cctgacatattcctggtgagcactccggaaggccaatcgatcgaggcaaagatccgtgag
cgtgctgacggcgccctcgttgccatttttggtggcgagcaacacgagatcgaaggtttg
gaggagccgcttggcttgagaatgattcttgacggccaaacgtggttgttgccgaccgtc
tttgatgcgtccgaacttcgcaccgacgttacaggtaagctcattcgcttcctgcaagat
gatggagctgaggtggtggctggcaagccgtacgctgaggttgaagcgatgaagatggtt
atgccgcttgttgccaccgagagcggtaagattaaccacgccaaggctgcgggtgctgtt
atcgaagccggtgacttgctcgcctcgctcacactcaaggatccaagcaaggtgaagaag
atcaccacgcacagtggcgcgcttcgcctgccagtctgtgacgaggctccgccaggccca
gaggaagctcttaacgccgccatcggccgggtcaacctctttctggacggctatgagctt
gacgctaatcaatgcgtctccgacctcctcagctctctcacgtcgctcccggcggatcaa
ggtcgctgggaacgcgcaacggatgtccttgatcaaatcattcagcgctatctcagcgtc
gaaagcgtgttcgaaggcaagaagttggacgctgtcatgcagcaactcatccgcgcgaac
agcagtaacttgcagccggttttagatcaagttcgatcgcacatgcgctcgaaggaacgg
caaggtctcatcttgagcctgctcaagcaggcgccgacgctgccgcagcgcgtcatgtct
cgaggtcccatttcgtgggcggacgatcacgctccgatctctgactccttgcgcaagaac
atcgaacgtctctccaagcttcgaggcggtgagtacggcgatatcgctgttcaagcctca
aacatattgcttgagcgcaggttaccgtcaatcgacaagcgtttggatgagttgaagaag
attctcctcggatctcagccgttgttgcgctcttggagcatcggtggcaaggccccgctg
cccggagatctccaatctctggttgagtcgccgacgttggcagtcgatttgttgccgtct
ctcttctctgataaggacgaaaaggtgcagaacgctgctctcgaggtgtactgcaagcgc
gtctaccgagctcacaatgtcctcagcacctcggtctctcgtgacaatggcatgacctcc
atcagctggaacttcaagttcaacacgttcccggatgagagcccgcttcgatgcggtatg
ctggctcgtgtggataccgttgcggacgccaagcaaaacttctccgccatgttggatcga
ctcgagtcaaacgtcaaggcggcgggcgcgggtgggtccagcgacacccagctgcacgtt
ctccatgtggccgtttgcaagcaaagcgccgacgatggcttgcccactgatcttgaggca
ttcatcgcttctcacaaggatcgactgaacgcgatgggcatcaagttcgtcaacttcctt
gcgtattctgatctcgagttgccggcctacttcaccttccactccggtaaggacttcaag
gaagatatgctgtacagaggtgagcgacccactgtcgcccacttgcttgagttagctcgt
cttgaaaacttcaagctcactcgacttccgacagtaaaccgagacttgcacatgtatgtg
ggtgagacttcggcgaacgtcggcaagcgtggtccggcaaagcacctcttgcttcgtcgt
ctttcccactccaaggatatgatggacggaggcctcgaacgcgtgctcggtaaggctttg
gaagccgtgtcactctcgttggtagacagcagagccaaaggggtttcctcctccaggctg
tatgtcaacttcttgccagtgttcgaagatctcaacttcaacacggccgtagccacaatg
aagagcaagctgaccgactacatcagccgcgagtcagctcagcttctcgctaagaaggtc
gatgagattgaggttcgcttccgtgtgggcaaggagaaggttccgcttcgattgatggcg
acttcaatgtctggccagtggctcaaggtcgacctctacaaggagtacctcgagtcaacg
agtggcaaggctgaacagttctgcttgctcggcccgaacggagaggaagaatcttgcttc
cttgagccgtacccgcagccgggtgcgctcgcgcagaagcgtgccgttgcacgcgcgatt
ggcacgacttacatcttcgacttccttggtctctttgagaaggctcttgtccttgactgg
cgcacccacattgctgatgtcggagggacgatgccgtccgacttctttagcgcttcggag
cttgttctcggtaatgatgggcaactcacgaaggaacaacgcccggcgggttcgaacaac
gtcgggatggtcggctggcattgcttcatgaagactcccgagtaccctgaagggcgcgaa
gttgtcatcgtcggcaatgactgcacgtacatgtctggttccttcggtgtcaaggaagat
gacgtgtacgatgccatttcgaagtacgctcgtaagttgggcttgccgcgtgtgtacatc
gcgtccaactctggcgcgcgaatcggcctcgtcgaagagcttaagccgtacttcaaagtg
gcttggacagatgcgtccaacccgggcttgggctacaagtacctgtatctcacgccagaa
gactacaagtccttcccggagggtactgtcaaggcggaagaggtcaaggaggatggtgaa
attcgcatgaagctcacagatataattggccaaattcatggcattggtgttgaaaacttg
cgaggctctggtatgatagcgggcgagcagtccgcagcgtatgcggatgccttcactctc
tcgtacatcaccggtcgctctgtaggtatcggcgcgtacctgtgccgacttggccagcgt
aacatccaaatgacgaatggtcccctgatccttaccggttacttggcgctcaacaagctt
ctcgggcgcgaagtgtacacgagccaagatcagcttggtggcccacaagtcatgatgcca
aacggtgtctcgcacttgcaagtcgccgacgatcaagaaggtgtcagatccatcttgaac
tggctctcgtacacgcctgctacgtcgaagtctcaagtgcgcgctcgtcgttcgtctgat
ccggtcgatcgtgacatcgacttcatgccgtcgaagactccttacgacccgcgcaacatg
ctcgcaggtgtcgaacagaatggtagcttcgcgaagggtttcttcgacactgactcgtgg
accgagactttgcccgactggggtaagtccgtcgttaccgggcgagcccgactcggtggt
gtaccgtgcggtgtcatcgccgtcgaaacacggatgatggagcagcgaatccctgctgac
cctgcgaaccctgagtctcgcgaggccgtgttggctcaagcgggtcaggtgtggttcccg
gatagtgcgcacaagacggctacggcgattcgtgatttcaacaacgctgagaacttgcct
ctattcatcttcgccaactggcgtggattcagcggtggtactcgggatatgtacggcgag
atcttgaagttcggcgcgatgattgtcgacgagcttcgcgtctaccgccatcctgtcttc
atttacattccgccgaatggtgagctccgcggtggtgcctgggttgtcgttgatccgacc
atcaacgagggacgaatggagatgtacgcggacgtggaatctcgagggggcatcctcgag
ccgccgggcatctgtgaggtcaagttccggcccaaggaccaactcgccgcgatgcaccgc
ttggatccggttcttatggaattggacaaggacgctgaagcgaacaaggacgagatcaag
aagcgtgagcaaaacctgttgccgatgtacacgcaagtcgctcacgaattcgccgacctt
cacgatcgcagcggtcgtatgaaggcgaagggtgtgattcgtgacgtggtcgagtggaag
aatgcgcgccgttatttccatggcagactcacgcgcagacttgctgtcgatgccttagct
agcaagatcaagtctgaacttggtgacatcaagctcgacagacctgtcgaggaatacatc
gaggaggcggtcgccgcgtcaggcgtcaacgccaatgacgataacgccgtcgccgcgatg
ctcgagagcaactcggcgaagattgggaacgacgtcatgatcaagggtcgtgctgccaag
gttgcccaatacgttgaaaagttaaagggcctcgacgctgaggacctcaaagccatcctc
gcccagatgtag

DBGET integrated database retrieval system