KEGG   Ostreococcus tauri: Ot01g04540Help
Entry
Ot01g04540        CDS       T01358                                 

Definition
NADPH-cytochrome P-450 reductase (ISS)
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
ota  Ostreococcus tauri
Brite
Enzymes [BR:ota01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     Ot01g04540
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BOGAS: 
UniProt: 
Position
1
AA seq 627 aa AA seqDB search
XVWMKTSGGRTTGSSVATGSEKDADDGTRTKLTVFYGTQTGTSERYARETLVRARAIDLE
TVDAMGAEDALQAETACAVFLQSTYGDGEPTDTSQDFVYWARDAANDGRMPDLLESLTFS
VFGLGNRSYEQFNAAAKMVHNALIGLGAKPLLKLHLGDDDQCLEQDFENWIEAFWPAFET
KFGLHSDGGDEDLPRYDVVMMDGGDGERAAATQAAKYEKEHSNARVAATATHPFLAPVKV
VRELYGNGADRSCVHVDFNISGTSLHYKTGDHLGVFAENGADIVKRVAKTLKCDVDSVFR
LEKPIDAPASLPEPFATPMTVGGAIARYVDVLSMPRKQALAALASVASDKDAKKLAFLAS
PAGKDEFAKYITKPHRSLLEVMEDYPSAVPDLGLFFGAIAPRLAPRFYSISSSPAADKNI
VTATVAVVKEKVATGREHEGVASTFLQRAAEGQKIPIFVRTSTFRLPQNPEAPIIMIGPG
TGYAPFRGFLQERTALKASGAKLGPAMLFFGCRNKDKDFMYEAEMQAALEDGVITSLDVA
FSRDGPKKVYVQDKIIEKASTVYPIVKGTVGKNEGAVYICGDAKNMARDVNKALLSVLMR
EGDYAAHEAEEILRRLKNEFRYHQDVW
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
ntggtgtggatgaaaacgtcggggggacggacgacggggtcgagcgtggcgacgggttcg
gagaaggacgcggacgatgggacgcggacgaagctcacggtgttttacggcacgcagacg
gggacgagcgagcggtacgcgcgggagactctggtgcgggcgagagcgatcgatttggaa
acggtggacgcgatgggggccgaggacgcgctgcaggcggagaccgcgtgcgcggtgttc
ttacagtcgacgtacggggacggcgaaccgacggacacgagccaggatttcgtgtactgg
gcgagagacgcggcgaacgacgggcgcatgccggatttgctcgagagtctcacctttagc
gtcttcggacttgggaatcgatcgtacgagcagttcaacgcggcggcgaagatggttcac
aacgcccttatcgggctcggggcgaagcctttgctcaagctccatctcggagacgatgat
cagtgcctcgagcaagactttgaaaactggatcgaggctttttggcccgcgtttgagacc
aagtttggcttacacagcgacggtggggacgaagacctgcctcgttacgacgttgtcatg
atggacggtggcgacggcgagcgcgcggcggcgactcaggcggccaagtacgagaaggaa
cactccaacgcgcgcgtcgccgcgacggcgacgcatccgtttctcgccccagtaaaggtt
gttcgcgagctttacggcaacggcgccgatcgaagctgcgtgcacgtcgatttcaacatc
tctggtacgagtctgcactacaagacgggcgaccatttgggagttttcgccgagaacggt
gcggatattgtcaagcgcgttgccaagactctcaagtgcgacgtcgactccgtcttccgt
ctggaaaagccgatcgatgccccggcatcgctccccgagcctttcgcgacgcctatgacg
gttgggggcgccatcgcgagatacgtggatgttttgagtatgccacgcaagcaagcgctc
gcggcactcgcatctgttgccagcgataaggacgccaagaagctcgcgtttttggcgtct
ccggcgggtaaggatgaattcgccaaatacatcacgaaaccgcacagatcgctgttggag
gtaatggaggactatccgagcgcggtgccggatctcgggctgttctttggggccatcgct
ccgagactggcgcccagattttacagcatcagttccagcccagccgcggataagaacatc
gtcaccgccaccgtggccgtcgtcaaagaaaaggtggccaccggacgggagcacgaggga
gtggcgagtaccttcttgcaacgagcggctgagggtcaaaagataccaatctttgtgcgc
acgagcacgttcagactgccacagaatccagaggcgcccataatcatgatcggtccgggc
acgggctacgcccctttcagaggcttcttgcaggaacgcaccgcgttgaaagcgtcgggg
gcgaagttgggccccgccatgttattctttggctgtcgcaacaaggataaggacttcatg
tacgaagcagaaatgcaagctgcgcttgaggacggagtcatcacgagtcttgacgtcgca
ttcagtcgcgatggtccaaagaaagtttacgtacaagacaaaattattgaaaaggcgagc
acggtgtatccgatcgtgaagggcacggtcggtaagaacgaaggtgccgtttacatttgt
ggtgacgccaagaatatggccagagacgtgaacaaggcgttgctgagcgttttgatgcgc
gaaggcgactatgccgcgcacgaggctgaagagattcttcgaaggttgaaaaacgaattt
aggtatcaccaagacgtgtggtag

DBGET integrated database retrieval system