KEGG   Ostreococcus tauri: Ot01g05130Help
Entry
Ot01g05130        CDS       T01358                                 

Definition
target of rapamycin protein (ISS)
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
ota  Ostreococcus tauri
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BOGAS: 
UniProt: 
Position
1
AA seq 2248 aa AA seqDB search
MCAIESEGEDDKDGGVNAGEFALRDRAETEARSADAGIFLGFGTRADTAKKMGGLRAIDQ
LIDVEFGEEVEKVRKFAEYVLEVMPPGGEERAQTKGEGARHPVDARNPLWGLPSAPQLIE
LMTAVIGRLVAHGGALTTDIVDSHVQRAVDLLETKEDNKEALSMKHYAAVRTLSELARNA
PTIFNVHVQIVVVAIWSALRDPSLQVREAAVSALRDCLMVIEQRETRYRVQWYYSLYESC
RVGLRSESSVEAMHGSLLALGELLRYTGEFMLSRYREVAQTIFRLQDCKASIIRRTIVLL
IPKLAVFSPRRFAESYLVESCALILTTIRASSDSGAGFEALSQLADAMSHVINLSTISPE
KADVGGVLLRYLPEVSAVMYDLFTTRARDQQGTPEALKCAGSLMNSLNEAWKPHFMNLMT
PMFMGDLSEALVSGLDFVAKSSPELMPEIQMKLADSIESAISQGPETVTPNRKTVQLALR
TMRTFPFEAVALLRAIKKNVVPYLSDSSAETRLEAALTCCSTLRLRVGSSKSATRAVEYI
MAALIPVAVGDTDASIRSSLLSDFCRPCASIDSYLGQAKSLRALFLTVNDESVTIRMLGI
ELLGHLATRNPAYVLPALRAHMLQLLAELEFSSESLHREESAKVLAVLIRSCPRFVAPYL
SAILNVLTATLRADEGGSSATSTSTRESMTALKGRLQRTGSSGSGALTSSIPATLRKRRD
VTGREKAAVLGTIGELANVSGSEIKPFVQPLLALLLIALKSPSTRDEAVVTLGKLIESSG
YVADPFTTHPQLLPQLLRILANERGIARNEVLRTLGCLGALDPYAHKANEIRLHGEGVLS
ADGVRGVRQASLKLAAGTGEDDILDEFLNNADGDDEIDVLPTLHLTSLSDEYYPTIALNS
LLRILRDPTRTSHRLMVIRSIVYIFQVLDTGCVQYLPNVLPVMLNVIRTSDPSRREDMFV
ELATLVSVVKAHIRRYLTDIFELMHLTWDVTGMSKNTILLCEELSFALNDEFRKNLPTII
PSVVAALGEAERLRKYDLVPHILHALECFGVSLNDHLYLLMPPIMRLLKHSVISVPVEIK
KCTLESLRRLLPIMNLSDQAALIVHSLTRVLDDERMELRMEALCVLTSLEVSLGRDYALF
LPVVKRAVSKCGVNDPAFDEMVKRVESGNVLLYPDEELETSSVVATARKKPDIQRRLSVN
QLAIRRAWESSQRSTKEDWLEWMRQLALDLLKSSPLPSLRACSELAQVQPNLARDLFCAS
FVSCWAELNESHREVLVRSLEAALGSPTIPPEIVSILLNLCEFMEHDEKPIPVDVRTLGM
IAERSRAYAKALHYKELEFVTNPGACVAAIIAINNQLQLPEAARGVLVYAQENLSVVIKE
SWYEKLEQWDDALEAYKRKMDEVMHVTTPNAMEERREAMAGQLRCLNALAEWEEIHRISE
IATKSNVDWDDYSIDVTTIATKAAWYLGDWEQMEVLTDKLERDQRSQGRLPTADRAELVS
KHKTSVVNVTDCDFYKSIIAFRKGNQEEARTHLSAARDKLGTELPALVRESYDRSYRALI
RAQQLTELDEVIEYAQLTAVASPAALQRQEVIRKMWRDRIYLVKRDVEVWQELLQVRSLV
LPMSEETDIWLKFAALNRKQGRDRQSRRTLLRLLGYDPMLCAEETAGFGAGSGRPKVMFA
FIKHLWHTGQKRQAFMRLQSLAHELRVTWENQRSSGQPPEVEHNKTVSRAFLKLGKWRWA
LTDCMNDETLTDVLMAFRTATAADQQWSKAWHHWALFNATAMEHFHRQGGASTQDAMQHV
APAISGFFRSIALGGGKTNAKQGGSLQDILRLLTLWFNHGGTAEVETALIEGFGHVSIDT
WLAVIPQIVARIHTHVIPVRNLIYQLLIRVGRQHPQAVLYPLLVACKSQSTSRRAAANAI
LDNVRQHSALLVEQAQIVSLELIRVAIVWHEAWHEALEEASRLYFGEQNVDGMMAVLTPL
HHILERQGAETLQEMGFVQNYGRELQEAHDLCQKYQMSKREEELNQAWDLYYHVFKRITK
QLPTMTTLELQYVSPRLLNSRGLELCVPGNYISRATEQAKSERCTDDAYGKDYGYLLKGH
EDLRQDERVMQLFGLVNTLLNSNMTTQQKDLGIARYAVVPLSPNSGLIGWVPNCDTLHAL
IREYREAHKIPLNLEHRMMLAMAPDYDHLPLVNKVEIFMHAVENTSGGDLAHVLWLKSRS
SEHHVHGGLPSRTRRSTSIKLDDRSIQR
NT seq 6747 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgcgatcgagagcgagggcgaagacgataaggacggtggagtaaacgccggggag
tttgcgctgagggatcgggcggaaacggaggcgaggagcgcggacgcggggattttcttg
ggtttcggaactcgcgcggacacggcaaagaagatgggtggtctgcgagcaatcgatcag
ctcatcgatgtcgagttcggagaggaggtcgagaaggtgcgcaagtttgcggagtacgtg
ctcgaggtgatgccaccgggaggtgaggaacgggcacagacgaagggtgaaggcgcaaga
cacccggtggacgcgcgcaatcctttgtgggggcttccgagcgcaccgcagcttattgaa
ctcatgacggcggttataggtcgactcgtcgcgcacggtggggcgcttacgacagacata
gtagattctcacgtgcagcgcgcagtggatttgttggaaacgaaggaagacaacaaggag
gcgctgagcatgaagcactacgcagcggtccgcaccctgtcggagctcgcgcggaacgcg
ccgaccatctttaatgtgcacgtacaaatcgtggtggttgcaatctggtcggcattgcgc
gatccctctttgcaggttcgcgaggctgcggtctcagctctcagggactgtttgatggtg
atcgagcagagagagacgaggtaccgggtgcagtggtactactcactgtacgagtcgtgt
cgggtcggattacgatcggaatcgtccgtggaggccatgcatggttctctccttgcgttg
ggtgaactgctgagatacaccggcgagttcatgttgagtcgttatcgtgaggtcgctcag
acaatttttcgtcttcaagactgtaaggcttctattattcgaaggaccatcgtgttgttg
attccaaagctcgccgttttcagcccgcgacgttttgcggagtcttatctggtggaatcg
tgcgcactgattctgacgacgattcgagcttctagtgatagcggagcaggatttgaggcg
ctcagtcaattggctgacgccatgtcgcacgtgatcaatctcagtacgatcagccccgaa
aaggcggatgtcgggggtgttctgctccgatatctaccagaagtcagcgcggtgatgtac
gatctcttcacaactcgagctcgagaccaacaaggtactccggaggctctcaagtgcgct
ggctcgttgatgaattcgttaaacgaggcttggaagccacacttcatgaacctgatgacg
ccgatgtttatgggcgatttgtccgaggctctggtgagcggtttagatttcgtagcgaag
agctcgccggagttgatgccggagatccagatgaaacttgcagattcaatcgagagcgca
ataagtcaagggccagagacagtgacgccgaatagaaagactgtgcagctcgctctacga
accatgcgcacgtttccatttgaggcggtggcattgctgcgtgcgattaaaaagaacgtg
gtgccatatttgagcgattcttcggcggaaacgaggcttgaggcggctttaacctgttgc
agcacgttgcgcttgagagttggatcgagcaagagcgcgacgcgcgcggttgaatatatc
atggctgcgctcattcccgtcgccgtcggagatacagacgcttctattagaagttcacta
ctttcggacttttgcagaccgtgcgcgtccatagactcgtacctaggtcaggcaaagtcg
ctcagagccctcttcttgacagtcaacgatgaaagtgtgacaatccgaatgttagggata
gaattactcggtcacttggcgacgagaaatccggcttacgtgttgccagctttacgtgca
cacatgttacagctgctcgcggaactagagtttagcagtgagtcgctgcacagagaggag
agcgcgaaggtgttggcggtgctcattcggagttgtcctcgtttcgttgctccgtatctc
tcagcaattttgaacgttctcacggccaccttacgagcggatgagggcggttcgtctgca
acgtcgacgtcgacgcgcgagagtatgactgcattgaaaggccgtctgcagagaacaggg
tctagcgggtccggagctttgacatcatccattccggccaccctacgaaagagacgagac
gtcactggacgtgaaaaagccgccgtgctcggtaccatcggcgagcttgcgaacgtgagc
ggaagcgaaatcaagccttttgtacaaccacttttagcactcttactgatcgctctgaag
tctccgagcacgcgagatgaggcggtggtgacacttggcaaattgatagaaagctccggt
tatgtggcggatccgtttacaacacacccgcagctcttacctcagttacttcgtatcctc
gcgaatgaacgtggtatcgctcggaatgaagtgctccggaccctcggttgcctaggagcc
ctcgatccatatgctcacaaggcgaatgaaattcgtctgcacggcgagggcgtcctcagt
gcggatggtgtgcggggcgttcgccaagcgagcctcaaacttgctgcgggtacgggagaa
gacgatattttggatgaatttttgaataacgctgacggagacgatgagattgacgtccta
cctacgctccatttgacgtctttatcggacgagtactatccgacaatcgcgttgaattcg
ctgctgagaattcttcgagaccctactcgcacgagtcatcgtctcatggtcatcagaagc
attgtttacatttttcaagttctggacacgggctgtgtgcagtatctaccgaatgtcctt
ccggttatgctgaatgtgattcgtacgagcgatcccagccggcgcgaagatatgtttgta
gaacttgcaactctcgtgagcgtcgtcaaggcgcacattcgtcgatatttgacggatata
tttgaactcatgcatctcacttgggacgttactggaatgtctaagaacacgattttgctg
tgcgaagagttatcgttcgctctaaacgacgaatttaggaaaaatcttccgacgatcatt
cctagtgttgtcgcggcattgggtgaagcggaacgcttgcgcaagtacgatttggtaccg
cacatcctccacgcactcgaatgcttcggtgtgagtcttaacgaccacctgtatcttctg
atgccgccaattatgcgtttgctaaagcatagcgtcatatctgttcctgtggagatcaaa
aaatgcacgttggaatcgctccggagattactgccaatcatgaacctgtctgaccaggcg
gctcttatagtgcactcgttgacacgggtgctcgatgacgagagaatggagttgagaatg
gaagctctgtgcgttcttacgtctctggaagtctccctagggcgggattatgctcttttt
ctaccagtggtaaagcgtgccgtgtcgaagtgtggcgttaacgatcctgctttcgacgaa
atggtaaaacgcgtcgagtctggcaatgttttgctttacccggatgaggaacttgaaacc
tcatccgtcgtggcgacggcgcggaaaaagccggatattcaacggcgattatctgtcaac
caattagcaattcgtcgcgcttgggaaagtagccagcggtcaacgaaggaagactggctt
gagtggatgagacaacttgcactcgacttgctgaaaagctcgcctcttccatcgctacga
gcttgcagtgaactcgcgcaagtgcagccaaacctcgccagagatttgttttgtgcatcg
tttgtttcttgttgggctgagttgaacgagagtcacagagaagtactcgttcgttcgctg
gaagccgccctcggcagtccgacgattccaccggagatcgtatcaattttgctcaatttg
tgtgaattcatggagcacgatgagaaaccgattcccgttgacgttcgaacgttaggaatg
attgccgagagatctcgggcatacgccaaagcgttgcactacaaagaactcgagtttgtg
acgaacccaggagcatgtgtggcggcgatcatcgccataaacaaccagttgcagttgcca
gaggccgctcgaggcgttcttgtgtatgcgcaagaaaatctgagcgtcgtgatcaaggaa
tcgtggtatgaaaagctcgagcaatgggacgacgctttggaggcgtataaacgcaagatg
gacgaagtcatgcacgttactacgcctaatgctatggaagagcggcgcgaggcaatggcc
gggcagcttcgatgcttgaacgcactcgcagaatgggaagaaattcacagaatcagcgaa
atagctaccaagtcgaatgtcgattgggacgattacagcattgatgtgactactatagcc
acaaaggctgcatggtacctaggcgactgggagcagatggaggttctcactgacaagctt
gaacgcgatcagcgttctcagggacggctcccgactgctgaccgcgcggagcttgtctcg
aagcacaaaacaagtgtggtcaatgtcactgactgcgacttctataaatccataatcgcc
tttcgcaaagggaatcaagaggaggcgcgaacgcatctctccgctgcacgcgacaaactc
ggcaccgaacttcccgcgcttgtcagagaatcatacgatcggtcttatcgcgcgctgatt
cgtgcacagcagctcaccgaactcgacgaggtgatcgagtacgcacaacttacggccgtt
gcgtctccagcggctttgcagagacaggaggtcattcggaagatgtggagagatagaatc
taccttgtgaaacgagacgttgaggtttggcaagagctcttacaagttcgctcattagtt
ttaccgatgagcgaggagacagatatatggctcaaatttgcggcgctcaaccgcaagcaa
gggcgtgaccgtcagtctcgccgtacgctgctacgattgcttgggtatgatcctatgctc
tgtgcggaggaaacggccggtttcggcgcaggatctggacgaccgaaggttatgttcgca
ttcatcaagcatctctggcacactggtcaaaaaagacaggcattcatgcgactccagtct
ctagcgcatgagctgcgagtgacatgggaaaaccaacgatcatctgggcagccgccggaa
gtggagcacaacaagacggtttcgcgggcattcttaaagctcggaaaatggagatgggcc
ctgaccgattgtatgaatgatgagacactgactgatgtattgatggcgttcagaacagcc
acggctgccgatcagcagtggtcaaaagcctggcatcactgggccttgttcaacgccacc
gccatggagcacttccatcgtcaaggtggggcgtctacgcaagatgcaatgcagcacgtt
gcacctgcaatcagtggattcttccgctcaattgcgctcggcggtggcaagaccaacgcg
aagcagggcggttccttgcaggacatcttgcgtttactcaccctgtggtttaatcatggt
ggaaccgcagaagttgagactgcattgattgaagggttcggccacgtaagtatcgatact
tggctcgccgtcattccgcaaatcgtggcaagaatccacacgcacgtcattcctgtgcga
aatttgatttaccagctcctcattcgagttggtcgacagcaccctcaagcggttttatat
cctcttctcgtcgcatgcaagagtcaaagcacatccaggcgtgctgcagccaacgccatt
ttggacaacgtgcgccaacatagcgcactactcgtcgaacaggcgcagattgtatccctc
gaactcatccgagtcgcaattgtatggcacgaggcgtggcatgaagcgttggaggaagct
tcgagactgtacttcggcgagcaaaatgtcgacggtatgatggctgtgctcacaccgcta
caccacatcttagagcgacaaggcgcagaaactttacaagagatgggattcgtacagaat
tacggtcgtgagctgcaagaagcgcacgatctctgccaaaagtatcaaatgagtaagcgt
gaagaagagctaaatcaagcatgggacttgtactatcacgtgttcaaacgcatcacgaaa
caacttccaaccatgacaacgttggaattgcagtacgtctcgcctcgtttgctcaactct
cgcggcttggaactctgtgttccagggaactatatttcaagagcgacagagcaggctaaa
tcagagcgttgcaccgacgatgcatatggtaaggattacggctatctgctgaagggtcac
gaggacttgcgtcaggatgagcgcgtgatgcaactgttcggtttggtgaacactttactg
aacagcaacatgacgacgcagcagaaagatctaggtatcgcgcgttacgctgtcgtgcct
ctttcaccaaacagtggactgatcggatgggtgccgaattgcgacacgctacacgcgctg
atacgagagtatagagaagcgcataaaattccactcaatctggagcacagaatgatgctc
gcgatggcacctgattacgaccatttgccattggttaacaaggttgagattttcatgcac
gccgtcgaaaacacttcgggcggagatttggcgcacgttctctggttgaagagtcgtagc
agcgaacatcatgtccatggtgggctaccttctcggactcggcgatcgacatccatcaaa
cttgatgatcgatcgatacagcggtaa

DBGET integrated database retrieval system