KEGG   Ostreococcus tauri: Ot01g05580Help
Entry
Ot01g05580        CDS       T01358                                 

Definition
histidinol dehydrogenase (ISS)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
ota  Ostreococcus tauri
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ota00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Ot01g05580
  Amino acid metabolism
   00340 Histidine metabolism
    Ot01g05580
Enzymes [BR:ota01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Ot01g05580
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BOGAS: 
UniProt: 
Position
1
AA seq 349 aa AA seqDB search
XXSTLDADVQAAFDVAYDNIAAFHAAQARSGDVDVSRPIEPVGLYVPGGTAVLPSTALML
AVPAKIAGCKRVVLATPPRKDGSICPEVLYVAKKAGVTHILKAGGAQAVAAMGFGTETCP
KVDKIFGPGNQFVTAAKMALQNSDAMVSIDMPAGPSEVLVIADKDAPAAHVAADLLSQAE
HGPDSQVVLVTFPDVDLKAITDAVADQASKLPRAEITSKALGHSYAVVVDDMDAACDFSN
RYAPEHLIVNVENAESWLPKLDNAGSIFLGRWTPESVGDYASGTNHVLPTYGYSRMYSGV
SLDSFVKYMTVQELTKAGLDALGPHVARMATVEGLDAHRSAVTLRLGID
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
nnnnnttcgacgctcgatgcggacgtgcaggcggcgttcgacgtggcgtacgataatatt
gcggcgttccacgcggcgcaggcgcggagcggggacgtggacgtgtcgagacccatcgag
ccggtggggttgtacgtcccgggggggaccgcggttcttccgagcacggcgctcatgtta
gcggtgccggcgaagattgccggatgtaaacgcgttgttttggcgacgccgccgagaaag
gatggctcgatctgcccggaggtgctgtacgtggcgaaaaaggctggcgtgacgcacatt
ctcaaggctggcggcgcgcaagccgtcgcggcgatgggtttcggcaccgagacgtgcccg
aaggtcgataagatcttcggtccggggaatcagttcgtcactgcggcgaaaatggcgctg
caaaactcggacgcgatggtgtccatcgacatgccggcgggaccgagcgaggtgctcgtc
atcgcggataaggacgcgcccgccgcgcacgtggcggctgatctcctctcccaggccgag
catggaccggatagccaggttgtgttggtgacgtttccagacgtggatctcaaagcgatc
accgacgccgtggccgaccaggcgagcaagctgccccgcgccgagatcacgtccaaggcg
ctcggtcactcgtacgccgtcgtcgtcgacgacatggacgccgcgtgcgatttcagcaac
cgatacgcccccgagcacttgatcgtgaacgtagagaatgcagagtcttggttgcccaag
ctggacaacgcgggttcaatcttcctcgggcgatggaccccggagtccgttggcgactac
gcgagcggcaccaaccacgtgctccccacctacgggtactcgcgaatgtactccggcgtc
tccctggactctttcgtcaagtacatgacggttcaggagcttaccaaggcgggtctcgac
gcgctcggtccgcacgtcgcgcgcatggctaccgtcgagggcttggacgcccaccgtagc
gccgtcaccctccgcctcggcatcgattag

DBGET integrated database retrieval system