KEGG   Ostreococcus tauri: Ot02g03310Help
Entry
Ot02g03310        CDS       T01358                                 

Definition
histone deacetylase (ISS)
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
ota  Ostreococcus tauri
Brite
Enzymes [BR:ota01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     Ot02g03310
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BOGAS: 
UniProt: 
Position
2
AA seq 413 aa AA seqDB search
MVAKDRICYYYDEEVGRNYYGPNHPMKPHRLCMTHNLILAYDLHKHLQVYRPRESTNEEF
TQFHSEDYIAFLSKITPDKQQQHVLEMQRFNLGEDCPIFDHMLDFCRRYTGGSVDGARRL
NQGLSDVAINWSEASGFCYVNDLVLAILELLKHHARVLYIDIDIHHGDGVEEAFYVTDRV
MTVSFHKYGDMFFPGTGGLRDIGINSGKYYSVNVPLNDGIDDKIFVDLFKFVVQDVMDVF
QPGAIVLQCGADSLAGDRIGCFNISLKGHAECVSFVNSFKKPMLVTGGGGYTKSNVARCW
ANETATLLGRKLAEDIPYHENYYEYYADVAYKLRAYAPVWIENLNTPSYITQLKAQVREN
LRSLTHAPSVSFTESPSAELVPELDENDLNPDERYGGYLGRDDAVIHGTDFYD
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atggtcgcgaaggatagaatatgctactactacgatgaggaagttggcagaaactactac
ggcccgaaccatcccatgaagccacaccgtctctgcatgacgcataacttgattctagca
tacgatctccacaagcacttgcaagtttatcggccgagagagagtacaaacgaggagttc
acgcagtttcacagtgaagactacatcgccttcttatcaaaaataacccccgataagcag
cagcagcacgtactcgaaatgcagagattcaacctgggagaggattgccctattttcgat
cacatgttagatttttgtcgacgatacactgggggttctgtcgacggcgcacgacgattg
aaccaagggctttcagatgtcgccattaactggtccgaggcttctgggttttgttacgtc
aacgatctcgtcctagcgatactcgaacttttgaagcaccatgcaagagttctttacatc
gatatagatattcaccacggagatggtgttgaggaagctttctacgtgacggatcgtgtg
atgacggtcagttttcacaagtatggagacatgttcttccccggtacaggaggcctccga
gacataggcattaactctggtaaatattatagtgtgaacgtgccgttgaatgatggcatt
gatgacaagatcttcgtggacctgttcaagtttgtcgtgcaggatgtgatggatgttttc
cagccaggtgcaatcgtcctgcagtgcggtgccgattcgttggcaggtgatagaatcggt
tgtttcaatatttccttgaaaggacacgctgagtgtgtgtcgttcgtgaatagttttaaa
aaacccatgctagttacaggcggaggaggctacacaaagtcaaatgttgcacgatgttgg
gccaatgagaccgccactttattaggtcgaaagctggcagaagatataccgtatcacgag
aattactacgaatactatgccgatgtagcttacaagttaagagcttatgcgcccgtttgg
atcgagaacctaaacacaccatcctacataacgcagctgaaggcacaagtcagagaaaat
ttgagatcgctcacacatgcgccaagtgtttctttcacggagtcaccttccgcagaacta
gtgccagagctagacgagaatgatttgaatccagacgaaagatatggtgggtacttaggc
cgagatgacgctgtgatacatgggacagacttttacgactag

DBGET integrated database retrieval system