KEGG   Ostreococcus tauri: Ot02g04220Help
Entry
Ot02g04220        CDS       T01358                                 

Gene name
If4E
Definition
If4E eukaryotic translation initiation factor 4E (IC)
Orthology
K03259  
translation initiation factor 4E
Organism
ota  Ostreococcus tauri
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:ota00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Ot02g04220 (If4E)
Translation factors [BR:ota03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    Ot02g04220 (If4E)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BOGAS: 
UniProt: 
Position
2
AA seq 129 aa AA seqDB search
MGTDFHLFKEGIQPKWEDETCAKGGKWTYYVPKQKDGGELDECWLNLLLCMIGEQFSEST
EICGAVVSVRQKQHRIALWTKTASSEPEQTAIGRHFKDILEVPESEKIGYMVHDDAIRLD
RRAKDRYTV
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgggaacggatttccatcttttcaaagaagggattcagccgaagtgggaggatgagacg
tgcgcgaaagggggtaagtggacatattacgttccgaaacagaaggatgggggcgagctt
gatgagtgctggttgaatctactcctgtgtatgattggagaacagttcagcgaatcgacg
gaaatctgtggagctgttgtcagcgttcgacaaaagcaacaccgtattgctctttggacg
aaaacagcgtcaagtgaacctgagcaaactgcgattgggcgacattttaaagacatcttg
gaggtgcccgagagcgaaaaaattggctacatggtacatgacgatgcgattcgccttgac
cgccgcgctaaagatcgatacactgtgtga

DBGET integrated database retrieval system