KEGG   Ostreococcus tauri: Ot02g04430Help
Entry
Ot02g04430        CDS       T01358                                 

Definition
acetyl-CoA synthetase (ISS)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ota  Ostreococcus tauri
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ota00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ot02g04430
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ot02g04430
   00620 Pyruvate metabolism
    Ot02g04430
   00640 Propanoate metabolism
    Ot02g04430
Enzymes [BR:ota01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Ot02g04430
Lipid biosynthesis proteins [BR:ota01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Ot02g04430
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BOGAS: 
UniProt: 
Position
2
AA seq 651 aa AA seqDB search
NMNSDDFMDVLRTCCSREQYDALYRESVEDPQNFWAKVAREFHWEEPWKSNVLAFNFNVD
NGKVDVSWFAGGKTNMAWNCIERNIQNGCGEQTAFIWEGNNLGEEGKKTYLELQADVNRL
ANWLKSAGVKKNDAVIIYLPMIMELPVAMLACARIGAVHSVVFAGFSSEALAQRLLGCKA
KVVLTCSAVMRGSKHINLKGVVDEACDFAAAKDHAVDHCLCFINARLNSDNHLTQSRDKH
WQNEVDQLPRDCETEWMDAEDPLFMLYTSGSTGSPKGVLHTTGGYMIYAGATCASVFNMR
QGDVFWCTADCGWITGHTYLTYGPLLNGATSIVFEGVPNYPDAGRCWNIIDKYKVKTFYT
APTALRALQRYGDDFVKAYKRSSLKILGTVGEPINPEAWQWYFNVVGEGRCPVMDTWWQT
ETGGHMITPLPLAIEQKPGSATLPFFGVEPVLLNENGVELLDEAEGYLCFKTPWPSMFRT
LFADHQRYEESYFSMFKGYYFSGDGAKRDADGYYWITGRVDDVMNVSGHRIGTAEVESAL
VTHAECVEAAVVGIDHPIKGQSIYAFVTLRESCELTNSTRKALVDCVRAMIGPFAAPDTI
QRAPALPKTRSGKIMRRILRKIASREEESLGDTSTLADPTVVDTLVELRDK
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
aatatgaacagcgatgattttatggatgttctccgaacgtgctgcagtagggagcaatat
gatgcactgtacagagaatctgtcgaagatccacaaaacttctgggcgaaagtagctcga
gaatttcactgggaagaaccgtggaagtcaaacgtgctggctttcaacttcaacgtagac
aacggcaaagttgatgtctcctggtttgctggtggcaaaacgaacatggcatggaactgt
atcgagcgaaatatccaaaatggctgtggagaacagacagctttcatttgggaaggcaac
aacttgggcgaagaaggtaaaaaaacttaccttgaactccaggctgacgtcaaccgcttg
gcaaactggctcaagtccgcgggtgtcaagaaaaatgatgccgtcattatttacttgcct
atgatcatggagcttcccgtagcgatgcttgcgtgcgcacgaattggagcagtgcactct
gttgtatttgcaggtttttcatcagaggcgttagcgcagagacttctaggatgcaaagcg
aaagtggtgctgacgtgttctgccgtcatgcgtgggtcgaaacatattaatttaaaggga
gttgtcgacgaagcttgcgattttgctgccgcaaaggaccacgcagttgaccactgcctg
tgcttcataaatgcgaggctgaacagcgacaaccatctaacgcagagtcgcgataagcac
tggcaaaacgaagtcgatcagctacctagagattgtgaaacagagtggatggatgccgaa
gatccacttttcatgctgtacacttcaggttctactggctcacctaagggcgtcttacac
actactgggggctatatgatttatgctggagctacatgtgcttctgtattcaatatgcgc
caaggcgacgtcttttggtgtacggcagactgtggctggataacaggtcatacttacctg
acgtatggaccacttctaaacggcgcgacatctattgtgtttgagggtgtaccaaattac
ccggacgctggtcgttgctggaatataattgacaagtacaaggtgaaaacattttacacc
gcaccaactgcgttgcgagccctacagcgctacggagacgacttcgttaaagcatacaag
cggtcttcgctaaaaatattgggtactgttggcgagccaatcaacccggaagcatggcaa
tggtacttcaacgtcgtgggagaaggacgctgtcctgtgatggatacgtggtggcaaaca
gaaacaggtggacatatgattactccattaccacttgccattgaacagaagcctgggtca
gccaccctccctttttttggagttgagcctgttctactgaatgaaaatggagttgagtta
cttgatgaagcagaaggctatctgtgcttcaaaaccccgtggccatccatgttccgaacg
ctgtttgcggatcaccagcgctatgaagagtcatatttctccatgttcaaaggatactat
ttctctggtgatggtgccaagcgtgatgctgatggttattactggataacaggtcgtgtt
gacgatgtgatgaatgtttccggtcaccgtattggaacagctgaagttgagtcggcgctt
gtcactcatgcagaatgtgttgaagctgccgtcgtcggtattgatcatcctataaagggt
cagtcgatatatgcgttcgtgactttacgcgaaagttgtgagctcacaaattccaccaga
aaggccttggtcgactgtgtaagagcgatgataggccccttcgcagcgcctgacacgatt
cagcgggcgccggctttacccaaaacacggagtggtaagataatgagacgaatcttacgt
aaaattgcttctcgagaagaagaatctctgggtgatacatcgacattggctgatccaacc
gtggtcgatacactcgttgagcttcgggacaag

DBGET integrated database retrieval system