KEGG   Ostreococcus tauri: Ot02g04440Help
Entry
Ot02g04440        CDS       T01358                                 

Definition
CHLI_CHLVU Magnesium-chelatase subunit chlI (ISS)
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
ota  Ostreococcus tauri
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ota00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Ot02g04440
Enzymes [BR:ota01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Ot02g04440
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BOGAS: 
UniProt: 
Position
2
AA seq 385 aa AA seqDB search
MASVTCKATLHSQRVTATVHFSSFDLMPDIVSSDAEEDTTARPVYPFAAIIGQEEMKFAA
MMNIIDPNIGGIMVMGDRGTGKSTTVRSLTDLLPYIEVVADDPYMSSPTDPNLMSPDVLA
AYRAKQPLETAFVPINMVDLPLGATEDRVCGTIDIEKALTEGTKAFEPGLLAKANRGILY
VDEVNLLDDHLVDVLLDSAASGWNTVEREGISICHPARFILIGSGNPEEGELRPQLLDRF
GMHAQIKTVKLPEERVKVVEERTAFDTDPKTFRARYKEKQDEIIDRVTRARTLLPEVEVP
MDIRLKISQVCAELDVDGLRGDLVTTRASRAAAAYRGSKVVTDEDVYSVVSLCLRHRLRK
DPMATIDEGSRVIEVFSSVFGYETE
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atggcgagcgtaacttgtaaggccacgcttcactctcagcgcgttaccgctactgttcac
ttctctagttttgatctgatgcccgatatagtatccagcgatgcggaagaggataccacc
gctcgacccgtttacccgtttgccgccatcatcggccaagaagaaatgaaatttgcggca
atgatgaatatcattgatccaaatattggtggtatcatggtcatgggtgaccgtggcact
ggaaagtcaaccacggttcgttctttgactgatttactaccttacatcgaggtcgtggcg
gatgatccgtatatgagtagtccgacagatccgaacttgatgtcacccgatgttttagca
gcttacagagcgaagcaaccactcgagacggcgttcgttcccatcaacatggttgacctt
ccacttggtgcaacagaagaccgcgtctgcggtaccattgatatcgaaaaggcgctaacc
gaaggcacaaaggcatttgaacctggactactcgctaaggctaatcgaggaatcctctat
gttgatgaggtcaacttgcttgacgatcaccttgtcgacgtcttacttgactctgctgct
tcgggctggaataccgtcgagcgtgaaggtatcagtatttgccatcctgcacgatttatt
ctcatcggatctggtaaccctgaagaaggcgaactacgtcctcaactcttggatcgcttt
ggtatgcacgctcaaattaagacagtaaagttaccagaggagcgcgtcaaggtggttgaa
gagcgcaccgcatttgacactgatccgaagactttccgagctcgatacaaagagaagcag
gatgaaattatagatcgggtcactcgcgctcgcactttgttgccagaagttgaggttccc
atggacattcgattgaaaatttcacaagtttgtgctgaacttgatgtggatggccttcgg
ggggatcttgttaccactcgcgcgtctcgggccgccgccgcgtacagagggtcgaaagta
gtcacagatgaagatgtatactctgttgtgtcgctttgcttgcgccataggctccgcaag
gatccaatggcgacgatcgatgaagggtctcgcgtgatcgaggtgttctcctctgtgttt
ggctacgaaacggagtag

DBGET integrated database retrieval system