KEGG   Ostreococcus tauri: Ot02g05010Help
Entry
Ot02g05010        CDS       T01358                                 

Definition
Anthranilate synthase component II (ISS)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
ota  Ostreococcus tauri
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ota00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Ot02g05010
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Ot02g05010
Enzymes [BR:ota01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Ot02g05010
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BOGAS: 
UniProt: 
Position
2
AA seq 356 aa AA seqDB search
AMTTATRTTHAGARARGTGGRRARARVNVARAANATDDGAVSIRRRPPSGPSKHALGVGQ
FEFMIEEVNDKGERVTNEENRPRNILEEIVWYKDVELAERKEKFPLQLVRTALVNAPPTR
DFVKAITDQLEATKQPGLIAEVKKASPSKGVIQPNFDPVKIAKAYEAGGAACLSVLTDEK
FFQGGFENLQLIREAGVTCPLLCKEFIVDAYQIYLARKYGADAILLIAAVLPNQDLKYFI
KIAHSLGMKCLIEVHTYGEMKRVLDGDFPIDLLGINNRDLGTFEVSLSVTTDLMNGPLGE
EVKERGITMVGESGIFTIDDVNLLQDSGVGAVLVGESLVKQDTPDVGIKKLFGRPL
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
gcgatgacgacggcgacgcggacgacgcacgcgggcgcgcgcgcgcgagggacgggcgga
cggcgcgcgcgcgcgcgcgtgaacgtcgcgcgggcggcgaacgcgacggacgacggcgcg
gtgagcattcgacgacgaccgccgagcggaccgtccaagcacgccctgggcgtcggacag
tttgagttcatgatcgaggaagtgaacgataagggcgagcgggtgacgaacgaggagaac
agaccgaggaacatcttggaggagatcgtgtggtacaaggacgtcgagctggcggagcga
aaggaaaagtttccgctgcagttggtgcgaacggcgctggtgaacgcgccgccgacgcgg
gattttgtgaaggcgatcacggatcagctcgaggcgacgaagcaaccgggattgatcgcg
gaggtgaagaaggcgtcgccgtcgaagggggtgattcagcccaactttgacccggtgaaa
atcgcgaaggcgtacgaggctggtggagcggcgtgtctgagcgtgctgacggacgaaaag
ttcttccagggtggattcgaaaacttgcagttgattcgcgaggccggggtgacgtgcccg
ctgctatgcaaggagttcatcgtcgacgcgtatcaaatttacttggctcgcaagtacggc
gccgacgcgatccttttgatcgccgctgttttgcccaaccaagacttgaagtacttcatc
aagatcgcgcactcgcttgggatgaagtgcctgatcgaggtgcacacgtacggcgagatg
aagcgcgttttggatggcgactttcccattgatttactcggcatcaacaaccgcgacttg
gggacgttcgaggtgagcctgagcgtgaccactgatctgatgaacggcccgctcggcgag
gaggtaaaggaacgcggcatcaccatggtgggcgagtccggtatcttcaccatcgacgac
gtgaacctcttgcaagattccggcgtcggcgccgttttggtcggcgagtctctcgtgaag
caagacaccccggacgttggcattaagaagctcttcggccgcccgctt

DBGET integrated database retrieval system