KEGG   Ostreococcus tauri: Ot02g05750Help
Entry
Ot02g05750        CDS       T01358                                 

Definition
DPE1 (ISS)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
ota  Ostreococcus tauri
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ota00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BOGAS: 
UniProt: 
Position
2
AA seq 593 aa AA seqDB search
AMFRTTTHRSLPAKRTERAASGRNSLAKRVRKVQATAVGSPVDADYGARFPPKRDDRRAG
VIMHPTSLPGAYGVGDAGPEARAFVDWLQKARMRIWQVLPLVPPGRPIPGVREDYWSPYS
GRDAHCGNTLMISLDDLVRDGLLRAEELPKAYGKTKVEFGAVAATNEPLIAKAAERLLAM
PRGEGLRGEYDAFCAREDVRAWLDPAAVFDAIDTTPALIGKYWWDWPVEYRDRDPSALAA
IERDRADSIELFKAVQFLFHLQWMRLKKYANERGVSLIGDMPIYVGGHSADVWANQNLFL
LGEDKKPSALAGVPPDAFSEDGQLWGNPLFAWQEHSRTDYAWWAQRLKRTLELHDEVRID
HFRAFAAYWEVEAGAPTAKSGRWITGPGIEMFERLKPALGDAKIVAEDLGVITADVVALR
EACGFPGMVVLQFAWGGDGRNPHLPHNHYENSFCYPGTHDNETSQGWYMSQDEDTKRRLD
AYAGVGYGDGAWGMIKAGMSSVSKACVFTMQDVLALGNEARMNTPGVADGNWAWRIGEPG
VFATLDAEADKLASLATVYDRVAVVDDSSMRDACIAIAGKGRGVLFGLGVWFL
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
gcgatgttccgaacgacgactcaccgctctctgcccgcgaaacggaccgagcgcgccgcg
agtggacgaaactcactcgcgaaacgcgttcggaaagttcaagccaccgccgtgggatcg
cccgtcgacgccgattacggcgcgcgtttccctcccaaacgcgacgacagacgcgctggt
gtgatcatgcatcccacgtcccttcccggcgcgtacggcgtcggcgacgccgggcccgag
gcgcgggcgttcgtggactggttacaaaaggcgaggatgcggatttggcaggtgttgccg
ctcgtaccgccgggacgaccgattccgggcgtgcgagaggattactggagcccgtacagc
gggcgagacgcgcactgtgggaatacgttaatgatttcgctggatgatttggtgcgcgat
gggttgttacgagcggaggaattgcccaaagcgtacggaaagacgaaggtggaattcgga
gctgtggcggcgacgaacgaaccgctcatcgcaaaggcggcggagcggttgttagcgatg
cctcgtggtgagggtctgcggggggagtacgatgcattctgcgcgagggaggacgtgcgg
gcttggttagatccggcggcggtgttcgacgcgatcgacaccacgccggcgctcatcggg
aagtattggtgggattggccggtggagtatcgcgatcgggatccgagcgcactcgcggcg
attgaacgcgatcgagcggattcaatcgagctcttcaaggcggtgcagttcttgtttcac
ttgcagtggatgaggttgaagaagtacgcgaacgaaagaggggtctcgctcattggagat
atgccgatttatgtcggtggccacagcgccgacgtgtgggccaaccaaaatttatttctt
cttggagaggacaagaagccgtccgcgttggccggggtgcccccggacgcgttctcggag
gacgggcagctgtggggtaatcctctgttcgcgtggcaagagcattcgcgcacagactac
gcgtggtgggcgcaaagactaaagcgcactctcgagcttcacgacgaggttcgcatagac
cacttccgcgcattcgcagcgtattgggaggtcgaagccggtgcgccgacggccaagagt
ggtcggtggatcaccggtccggggatcgaaatgttcgagaggctcaaacccgcgctcggt
gacgctaagattgtcgccgaggacctgggcgtgatcaccgccgacgtcgtcgcgctccgt
gaggcgtgcggattcccgggcatggtagtcctacaattcgcttggggtggtgacggtcgt
aacccacacttgccgcacaaccactacgagaactcgttctgctatccaggcacgcacgac
aacgagacgtctcaaggttggtacatgtcacaggatgaggacaccaagcgacgactcgat
gcgtacgcaggtgtcggctacggcgacggtgcgtgggggatgatcaaggccgggatgtcc
agcgtcagtaaagcgtgcgttttcaccatgcaagacgtcctcgctctcgggaacgaggcg
cgcatgaacaccccaggcgtcgccgacggcaactgggcctggcgtataggtgagcccggc
gtcttcgccacgctcgacgccgaggccgacaagctcgcgagtttagccaccgtgtacgac
cgtgtcgccgttgtggacgatagttccatgcgcgatgcgtgcatcgcaatcgccgggaag
ggccgaggcgttctctttggcctcggcgtctggttcctc

DBGET integrated database retrieval system