KEGG   Ostreococcus tauri: Ot02g05760Help
Entry
Ot02g05760        CDS       T01358                                 

Definition
cGMP-dependent protein kinase, putative (ISS)
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
ota  Ostreococcus tauri
Brite
Enzymes [BR:ota01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     Ot02g05760
Protein kinases [BR:ota01001]
 Serine/threonine protein kinases: AGC group
  PKG family
   Ot02g05760
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BOGAS: 
Position
2
AA seq 935 aa AA seqDB search
LMSRDVLTTAAASWDAFAREDIDRDASSSENASKTLENARAGTRRARARKRFAVGDAPRA
STRDALKSTSVVERPGERTTASEQAIERAMEGNLLFAELDAASRRRVADAMMPMYVGEND
VVIAQGDDECERFYIIESGEASVMKNEVGKRTSLSTDSANETTRTESLGQSKSVVYDPAT
ATCVATLGPGRGFGELALLYACPRSATIVAQTPMKLWTLHSSAFKAIKHSVAKREAMDVL
DLFERVELFNALSEQQLITISNAARRETYEARDEVFRQGDPGHCFYIIERGEVSVRVNGA
EVVKLSRGDFFGERALVNNEPRAATIYAMTEVSCLVLNRQTFVSMLGSIEEARCFAGLAE
CPILAPLSDVQLTDIAGEMRMCSYVRNDVVFHENAMGDAFYVIIDGQFSVTTSTSKDPVA
TLNRGQYFGELALLRKDKRAATITCVSNRAKVAFMTKSAFEKKMGNLDVLRKAWRFETLS
KVPILSKLSPEEIQNLAEELTDVSFRANETVIKQGESGDAMFILESGEVEVIDEKTLNTS
GDPKLLCKLGPSSYFGELGLLNSDPRAATVRVPNRATVLVITRRVFEQHLGSLKEILKRN
ANELYAKIGRPAHRRPVTATLDELETVGFLGVGSFGRVTLVSYQGETYALKEIGKAQVVS
RGLVEHVWREKETMAQCDSPFLVNLHRTYVNEKSIFMLMDKVLGGELFTYLQMRNAPLPE
AHGKFYAACVVSAFEYLHDRNIIYRDLKPENLLISTNGYLKVTDFSFAKKLQKGQKTFTL
CGTPQYLAPEQVQQVGHNRAVDWWALGVLIYELVNGLPPFNQDDDYARYKAINDVSFHFS
PKNAPAFRSVVSGLLLRLPAGRLGMGKSGARDIKQHPWFADVNWSAMAQQRARAPYIPRV
DDISDLRHFVDTGDAVPGLSSRWGHYVSVGRFADF
NT seq 2805 nt NT seq  +upstreamnt  +downstreamnt
ctcatgtctcgcgacgtcctcaccaccgccgccgcgtcctgggacgccttcgcgcgcgag
gatatcgaccgcgacgcttcgtcttccgaaaatgcgtcgaaaacgctcgagaatgcgcgc
gcggggactcgacgggcgcgcgcgcgtaagcgcttcgccgtcggcgatgccccacgagcg
agcacgcgggatgctttaaagtccacgagcgtcgtcgagcgaccgggcgagcgcacgacg
gcgagcgagcaggcgatcgagcgcgccatggagggaaatctgctctttgctgagctggac
gcggcttcgcggcgacgcgtggcggacgcaatgatgcccatgtacgtcggcgagaacgac
gtcgtgatcgcgcaaggggacgacgagtgcgaacggttttatatcatcgagagcggtgag
gcgagcgtgatgaagaacgaggtcggaaagcgaacgagtctgtccacggatagcgcaaac
gagaccacacgcacagagtcgcttgggcagagtaagtcggtggtgtacgatccggccacg
gcgacgtgcgtggcgacgctcggcccagggcgtggattcggtgaattggcgctcctgtac
gcgtgtccgcgatcggcgacgatcgtcgcgcagacgccgatgaagctgtggacgcttcac
tcgagtgcgttcaaggcaatcaagcactccgtggcaaagcgcgaggctatggacgtgctc
gatcttttcgaacgcgtcgaactatttaacgccctctccgaacaacagctaatcacgata
tctaacgcggcgaggcgagagacgtacgaggcgagagacgaggtgttccgtcagggcgat
cccgggcactgtttttacattatcgagcgaggcgaggtgagcgtgcgcgtcaacggcgcg
gaggttgtgaagctctctcggggtgacttcttcggcgagcgggcgctggtaaacaatgag
cctcgcgctgcgacaatctatgccatgacggaagtctcttgtctggtactcaatcgacag
acgtttgtgtcgatgctcggctccatcgaggaagcgcggtgctttgcgggcctggcggag
tgtccgatcttggcacctctgagcgatgttcagctcacagatattgcaggtgagatgcga
atgtgcagttacgtccgaaacgatgtcgtgtttcacgagaacgcgatgggtgatgcgttt
tacgtcatcattgatggccagttttcggttacgacgtcgacttcgaaagatcccgttgca
acgttgaatcgaggacagtacttcggtgaactcgcgctactgcgcaaggacaagcgtgca
gccacgatcacatgtgtgagtaatcgtgcgaaagtggctttcatgaccaaatccgccttt
gaaaagaagatgggcaacttggacgtccttcgcaaggcttggcgatttgaaacgctatcc
aaagtaccgattctgtccaagttatcacccgaggagatacaaaatctcgccgaggagctc
acggacgtttcgtttcgagcgaacgagaccgtcatcaagcaaggagaatccggggacgcg
atgttcattctggaatctggtgaggtcgaggtgatcgatgaaaagacgctcaacacatcc
ggcgatccaaagttgttgtgcaagcttggaccgagctcgtacttcggagagctcggtttg
ctgaactccgatccacgcgccgcaacagtgcgcgtgccgaatcgggcgaccgtgcttgtg
atcacccgtcgcgtctttgagcaacatcttggcagtctcaaggagatcttgaaacgaaat
gcgaacgagctgtacgcaaagatcggtcgtccagcccacagaagaccagtcacggcgacg
ctcgatgagcttgaaactgtcggttttctaggcgtcgggtctttcggtcgcgtcacgctc
gtctcttatcagggcgagacgtacgccctgaaggagattggaaaggcgcaagtcgtctcg
cgtggattggtcgagcacgtgtggagagaaaaagaaaccatggcgcagtgcgactccccg
ttcttggtgaaccttcatcgcacgtacgtgaatgaaaagtcaattttcatgctcatggat
aaagtcttgggcggagagctgttcacgtatctacagatgcgaaatgcacccttacccgag
gcgcacggcaagttttatgctgcgtgcgttgtctcggcctttgagtacctacacgaccga
aacatcatctatcgcgatctcaaaccggagaacttactaatttccacgaacgggtacctc
aaggtgacggacttttcgttcgcgaagaaacttcaaaagggacaaaagacgtttacgttg
tgcgggacacctcaatatttggcgcccgagcaggtgcaacaggtcggtcacaaccgcgcc
gtggattggtgggccctgggcgtattgatctacgagctcgtcaacggtttacctccgttc
aatcaggacgacgactacgcccggtacaaggctatcaacgacgtgagctttcacttttcg
cccaagaacgctccggcgttccgatctgtcgtctccggcctcctcctccgccttcccgcc
ggccgactcgggatgggcaaatctggcgcccgcgacatcaaacagcacccttggttcgcg
gatgtaaactggagcgcgatggcgcagcaacgtgctcgagcgccctacatcccgcgagtg
gacgatatctccgatttgcggcactttgtcgacaccggcgacgccgtcccaggattgagc
tcgcgctggggacactacgtctccgtcggtcgcttcgctgacttt

DBGET integrated database retrieval system