KEGG   Ostreococcus tauri: Ot03g00840Help
Entry
Ot03g00840        CDS       T01358                                 

Definition
1,4-alpha-glucan branching enzyme (ISS)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
ota  Ostreococcus tauri
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:ota00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Ot03g00840
Enzymes [BR:ota01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Ot03g00840
Exosome [BR:ota04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Ot03g00840
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BOGAS: 
UniProt: 
Position
3
AA seq 846 aa AA seqDB search
MSRARASCARAPARVDARSGWRRRSARTLAKRRAGGDDFDIDSVTKAVEALRLENERLKA
SLEAEENAVSVGTKAAVVEAAAVESTSEPVVESTSESVVESIPEPAFAAVAPAPVGAFNE
AADRLEGFKFPALDGDGLGVCATDPSLESHRGHLEYRWNKFKGLRQAIEDNEGGLEKFSR
GYEKMGFTRTAEGITYREWAPNASAACLRGDFNGWDLGENGKWMTKNDFGVFEVFLPNNE
DGSPAIPHGSRVKIHLQIPNAEPVDKIPAWIKYAVQQPGEIPFNGIYYDPPVEEQYNFKF
ERPDAPSELRIYEAHVGMSSTEPKINSYVEFADDVLPRIKDLGYNAVQLMAIQEHAYYAS
FGYHVTNFFAVSSRCGTPDELKYLVDKAHSMGISVIMDLVHSHASSNSMDGLNMFDGSNG
QYFHSGPEGYHWMWDSRCFNYGEWEVLRFLLSNLRYWIEEYKFDGFRFDGATSMMYKHHG
LQVAFTGNYDEYFGMATDVDAMVYLMLANDLLHTLYEGKMTTIAEDVSGMPTLCRPVKEG
GVGFDYRLQMAIADKWIEVLSEWGPDENWDMGNLVFTMENRRYGEKCISYAESHDQALVG
DKTTAFWLMDAEMYTNMSTLVPDTPTISRGIALHKMIRQFTMGLGGEGYLNFMGNEFGHP
EWIDFPRDDRVEASTGKFIPGNGNSYHLCRRRFDLTDMDHLRYKYLNAFDGAMNKVAGAF
KYLASSHQYTSCKSDADKVIVFERGDLVFVFNWNPTQSFSDYRIGCKEKTTYKLVLSSDN
PEFGGYSNLWTYTAPEFIAEDYAFNGRPASFLAYVPSRTVAVYAPADLADKLLGYSSEST
AADTAA
NT seq 2541 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgcgcgcgcgcgtcgtgcgcccgcgcgcccgcgcgcgtggacgcgcgatcggga
tggcgacgacgaagcgcgcggacgctcgcgaagcgacgggcgggcggagacgatttcgac
atcgattcggtgacgaaagcggtggaggcgctgaggttggagaatgagcggttgaaggcg
tcgttggaggcggaagagaacgcggtgagcgttgggacgaaggcggcggtggtcgaggcg
gcggcggttgaatcgacgtccgagccggtcgttgaatcgacgtccgagtcggtcgttgaa
tcgattcctgaaccagcttttgccgcggttgcgccggcaccggtgggcgcttttaacgag
gcggcggaccgcttggaggggttcaagttccccgcgctcgatggcgacggcttgggcgtg
tgcgcgacggatccttcgctcgagagccacaggggacacctggagtatcgctggaacaag
tttaagggcctgcgccaagcgatcgaagataatgaaggtggcttggagaagttcagccgc
ggttacgaaaagatgggcttcacgcgcaccgcggagggcatcacgtacagagagtgggcg
ccaaacgcctccgccgcgtgccttcgcggcgacttcaatggttgggatctgggagaaaac
ggtaagtggatgaccaagaacgacttcggcgtcttcgaagtgtttctcccgaacaacgaa
gatgggtctcccgcgatcccgcacggctctcgtgtgaagatccatctgcaaatcccgaac
gccgaaccggttgacaagattccggcttggatcaaatacgccgtgcagcagcctggtgag
atcccgttcaacggcatttactacgacccgcccgtggaggagcaatataatttcaagttc
gaacgcccggatgcgccttctgagcttcgaatttacgaagcgcacgtcggcatgtcctcc
actgagccgaagatcaactcttacgtggagttcgccgacgacgtgctgccgcgcatcaag
gacctcggttacaacgccgtgcagctcatggcgattcaagaacacgcgtactacgcgtcg
tttggctatcacgtcaccaatttcttcgccgtttcctcccgatgcgggactccggatgag
ttgaagtacttggttgacaaggcgcactccatggggatcagcgttatcatggatttggtg
cactcgcacgcgtcctccaactccatggacggcctgaacatgttcgatggcagcaatggc
cagtacttccactctggcccggagggctatcactggatgtgggactctcgctgcttcaac
tacggcgagtgggaggtgcttcgcttcttgctgtccaacttgcgttactggatcgaagag
tacaagttcgacggcttccgtttcgatggcgcgacctcgatgatgtacaagcaccacggt
ctgcaagtcgcgttcaccggtaactacgacgaatacttcggcatggcgaccgacgtcgac
gcgatggtttacctgatgcttgccaacgatctgctccacacgctttacgaaggcaagatg
accaccattgccgaagatgtgagtggcatgccgacgctctgccgaccggttaaggaaggc
ggcgtgggcttcgactatcgtctccagatggccatcgcggacaagtggattgaagtcttg
agcgaatggggtccggatgagaactgggacatgggcaacttggtgttcaccatggagaac
cgtcgttacggcgaaaagtgtatctcatacgccgaatcccacgatcaagcgcttgtcggc
gataagaccaccgcgttctggttgatggacgctgaaatgtacacgaacatgtccactttg
gttcccgacacgccgaccatctctcgtggcatcgctttgcataagatgattcgacaattc
accatgggtcttggcggtgagggctacctgaacttcatgggtaacgagttcggtcacccc
gagtggatcgatttccctcgcgacgaccgtgtcgaggcttccactggtaagttcattccg
ggtaacggtaactcgtaccacttgtgccgcaggcgattcgatctgaccgacatggatcac
ttgcgttacaagtacctgaacgcgtttgacggggcgatgaacaaggtcgcgggcgctttc
aagtacctcgcgtccagtcaccaatacacgtcgtgcaagagcgacgctgataaggttatt
gttttcgagcgcggtgacctggtgttcgtgttcaactggaacccgacgcagtccttctcc
gactaccgaatcggctgcaaggagaagacgacgtacaagcttgtgttgagctcggataac
cccgagttcggcggttactccaacctctggacgtataccgctcccgaattcatcgccgaa
gactacgcgttcaacggccggccggcatcgttcttggcgtacgttccctcacgcactgtc
gcggtgtacgctccggctgatttggcggacaagcttcttggttactcctccgagtccacc
gcggcggacactgccgcgtga

DBGET integrated database retrieval system