KEGG   Ostreococcus tauri: Ot03g01030Help
Entry
Ot03g01030        CDS       T01358                                 

Definition
Putative PAP-specific phosphatase (ISS)
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
ota  Ostreococcus tauri
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ota00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Ot03g01030
Enzymes [BR:ota01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     Ot03g01030
Transfer RNA biogenesis [BR:ota03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    Ot03g01030
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BOGAS: 
UniProt: 
Position
3
AA seq 427 aa AA seqDB search
MALASSTRASALSASVARRPPLSAFRRASRARHGRRARHAAASAVDTVPLGVDGGAYAKE
LASALDAVRLASELCQEVQGQLMRMDEQAETKEDRSLVTLADYAAQAIISWYARIAQDFP
DMTLVGEEDAEALTEGGEGGAETLNKVTNLVNKTLKGHMGEKAPTLSSQDVVDAINRGQS
TGGPTGKHWILDPVDGTLGFVRGDQYAIALALMDDGDLKVGVMGCPNMPKTGEVLEFQES
YAYGFSPRLVSKMLAGDSLGWYKGCIFTAVRGKGAYMFPTDPTLKFEPVKVSVSEAFDPR
KAKFTEPVMKANSSQGFTAAVATNLGIECKPLRIYSQVKYGSVARADADVFMKFPKAGYM
EKIWDHAAGVILVEEAGGTVSDAGGAPLNFAGGRYIEGLDRGIIAASSALHAKLLDSVAK
SWSSSQL
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggcgctcgcctcctcgacgcgcgcgtcggcgctgtcggcgagcgtcgcccgacgtccg
cctctgagcgctttccgtcgagcgtcgcgcgcgcgacacggtcgacgcgcgcgccacgcc
gccgcgtccgcggtcgacaccgtcccgctcggcgtggacggcggtgcgtacgccaaggag
ctcgcgagcgcgctcgacgcggtccgtctggcgagcgagctgtgccaggaggtgcaggga
cagctgatgcgcatggacgaacaggcggagacgaaggaggatcgatcgctggtgacgctc
gcggattacgcggcgcaggcgataatctcatggtacgcgcgcatcgcgcaggattttccg
gatatgacgctcgtgggcgaggaggacgcggaggcgctcaccgagggcggcgagggaggc
gctgagaccttgaacaaggtgaccaacctggtgaataaaacgctcaaaggacacatgggt
gaaaaagcgccgacgctttcgtcgcaggacgtcgtggacgcgatcaatagaggacaaagc
acgggcgggccgactggaaagcactggatcctggacccggtggatggaacgctcggattc
gtgcgaggggaccagtacgccatcgcgctcgcgctcatggatgatggagatttgaaggtc
ggggtgatgggatgcccgaacatgcccaagacgggcgaggtgttggagttccaggaaagc
tacgcgtacgggttttcgccaaggctcgtgtcgaagatgctcgctggggattcgctcggt
tggtacaagggatgcatcttcaccgcggtgcgaggcaaaggggcgtatatgtttccgacg
gatccgacgctgaagttcgaaccagtcaaggtttcggtgagcgaggcgtttgacccccgc
aaggccaagttcaccgaacctgtgatgaaggcaaactcgtctcaaggtttcaccgccgcc
gtcgcgaccaatctcggaatcgagtgcaagccgctgcgtatttactctcaggtgaagtat
ggttccgtcgcgcgcgcggacgcggacgttttcatgaagtttcccaaggctgggtacatg
gaaaaaatttgggatcacgccgccggggtgatccttgtggaggaggctggaggcaccgtt
tcggacgccggaggcgcgccgctcaactttgccggggggcgatacatcgagggtttggat
agaggcatcatcgccgcgtcttcagcgcttcacgcaaaacttcttgactcagtcgcgaag
tcgtggagttcctctcaactataa

DBGET integrated database retrieval system