KEGG   Ostreococcus tauri: Ot03g01250Help
Entry
Ot03g01250        CDS       T01358                                 

Definition
asparagine synthetase (ISS)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
ota  Ostreococcus tauri
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ota00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Ot03g01250
Enzymes [BR:ota01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Ot03g01250
Peptidases [BR:ota01002]
 Cysteine Peptidases
  Family C44
   Ot03g01250
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BOGAS: 
UniProt: 
Position
3
AA seq 649 aa AA seqDB search
MALSHVAFSGRRASLDMCGIFAVLRLTGDARKNRRRVYDLAKRLRHRGPDSYGMEVRVDE
RSGAQTFMVHKRLSIVAPGKSGDQPLYTDASRKTTFIANGEIYNHAELREKYGIVSENKS
DCQVIGHLYEQHGPGFVSELDGMFAFVIEDRENDVIVAARDHMGKIPMYMANGKDGSVWF
SSEMKTLHDDPGVASYEIFPPGHVYVKKGDEPATIERWFNPQWIAEESYVPTTPADLPAL
RECVVDAVTKRLMADVPYAVLLSGGLDSSLITSIAVRQRKLAKNTYGADEPVHSFSIGIK
GAPDLVAARKVAEQLGTIHHEVHFTPEEALDALPDVIWHLETFEQVRASVPMYLLSRHIK
SLGFKMVLSGEGADELFGGYLYFHKAPNPTEFHAECRRKTMRLHQWDVLRANKSTMSWGI
EVRTPLLSQQVIDMAMNMRPEDKMIDVNKKDADGHPFLEKYILRKAFDTPEDPYLPQEVL
WRQKEQFSDGVGYDWVDGLAAHAELEVSDEMFAKRAERFPLHPPTTKEYYLLRSIFEEHF
VTGFENGDCAYATCPFGKSIACSTPEAVSWDPEWEKSVGDISGRAVKNVHVAADKFDVKK
EKANETVAASLVGRGKASCSSESAVTFASLACVRRLSRGFYFCRAPPCL
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atggctctctcacacgtggctttttccggtcgacgcgcatcgctggacatgtgcgggatc
tttgccgttttacggctcacgggcgacgccaggaagaaccgccgacgcgtgtatgacctg
gcgaagcggctgcggcatcgggggccggattcgtacggaatggaggttcgagtggacgag
cgaagcggcgcgcaaaccttcatggtgcacaagcgcctgagcatcgtcgctccggggaag
agcggtgatcagccgctgtacacggatgcgtcgaggaagacgacgttcatcgcgaacgga
gaaatttataatcacgccgagctcagggagaagtacgggatcgtgagcgagaataagagc
gattgccaagtcatcggtcacctgtacgagcagcacgggccgggcttcgtgagcgagctc
gatgggatgttcgcgttcgtgatcgaggatcgggagaacgacgtcatcgtcgcggcgaga
gatcatatggggaagatcccgatgtacatggccaacggtaaggatgggagcgtttggttc
agcagcgagatgaagacgttgcacgacgacccaggggtggcgagctacgaaatctttccg
ccaggtcacgtgtacgtcaagaagggtgatgaaccggccacgatcgagcgctggttcaat
cctcaatggatcgccgaggagagctacgtgccgacgactccggcggacttaccggcgctt
cgcgagtgcgtcgttgacgccgtcacaaagcgtctcatggcggacgtcccgtacgccgtg
ctcctgtccggtgggcttgattcatcgttaatcacctccatcgcggtgcgtcagcgcaag
ttagccaagaacacgtacggagctgatgagcccgtgcactcgttctccatcggtatcaag
ggggcgccggatctcgtcgccgcgcgcaaggtggccgaacagctcggcacgatccaccac
gaggtgcactttactcccgaggaagcgctcgacgcactgccggacgtcatttggcacctt
gaaacgttcgagcaagttcgtgcgtcggtgcccatgtacctactgagccgtcacatcaag
tccttaggtttcaagatggtcctctcgggcgagggcgccgacgagctctttggtggctac
ttgtacttccacaaggcgccgaacccgaccgagttccatgctgaatgccgtcgtaagacc
atgcgtttgcaccaatgggatgtgttgcgcgcgaacaagtctacgatgagctggggtatc
gaagttcgcactccactcttgtcccagcaagtcatcgacatggcgatgaacatgcgtcct
gaggataaaatgatcgacgtcaacaaaaaagatgcagatggtcatccattcctggaaaag
tatattctccgcaaggcgttcgatacgcctgaggatccgtatcttccgcaagaggttctt
tggcgtcagaaggagcagttcagcgatggcgttgggtacgactgggtcgacggtttggcg
gcacacgctgaactcgaagtcagtgacgaaatgtttgcgaagcgcgccgagcgtttcccg
ctgcacccgccgacgacgaaggagtactacttgcttcgatcgattttcgaagagcacttt
gtgactgggttcgagaatggggactgcgcgtacgcgacatgcccgttcggcaagtccatc
gcgtgctcaaccccggaggcggtttcgtgggatccggagtgggaaaagagtgtcggagac
atctctggtcgggctgtcaagaacgtgcacgtcgctgccgacaagtttgacgtgaagaag
gagaaggcgaacgagactgtcgccgcctccttggtgggtcgaggaaaggcgtcgtgcagc
agcgagtccgcggtcacgttcgcttcgctggcttgcgtgcggcgcctatctcgagggttt
tacttctgtagggcgccaccctgcttgtag

DBGET integrated database retrieval system