KEGG   Ostreococcus tauri: Ot03g02120Help
Entry
Ot03g02120        CDS       T01358                                 

Definition
(RefSeq) putative phosphatidic acid phosphatase (ISS)
  KO
K18693  
diacylglycerol diphosphate phosphatase / phosphatidate phosphatase [EC:3.1.3.81 3.1.3.4]
Organism
ota  Ostreococcus tauri
Pathway
Glycerolipid metabolism
Glycerophospholipid metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ota00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Ot03g02120
   00564 Glycerophospholipid metabolism
    Ot03g02120
Enzymes [BR:ota01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.4  phosphatidate phosphatase
     Ot03g02120
    3.1.3.81  diacylglycerol diphosphate phosphatase
     Ot03g02120
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OrcAE: 
UniProt: 
Position
3
AA seq 291 aa AA seqDB search
MASSSGERGETAREAREEREETSNLMTRRARARTLAVDAVAFGLMFSLGTWLEVAEPNQK
YIQQEMLWRYSYPHKENTVPTVVVPIISFLIPLACMLAVPRSWNPHVRKERAIGGLTVSV
GLTWVVTCAMKNIIGNIRPDFVARCWPDGNIVWASAGVPKCSGANDDVQQGRRSFPSGHT
SMSFSGLFYCSLYLAAWFRVGREERKFRRWEAVWKLIVVLGPTLLAMFVGLTRIRDYWHH
WEDVLVGATLGTTFAYVSWVYKKPYVRPSGFGFNENYTPLGRSAEDFSLVD
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgtcgagcggtgagcgaggcgagacggcgcgggaggcgcgggaagagcgggaa
gagacgtcgaacttgatgacgcggcgcgcgcgcgcgcggacgctggcggttgacgccgtc
gcgttcgggttgatgttctcgctcgggacgtggctcgaggtggcggaaccgaatcaaaag
tacattcagcaagagatgctgtggcggtacagttatccgcacaaggagaacacggtgccg
acggtggtggtgccgatcatctcgtttttgattccgctggcgtgcatgctcgcggttcct
aggagctggaacccacacgtgcggaaagagcgagccatcggcggcttgacggtcagcgtt
ggtcttacgtgggtggtgacgtgcgcgatgaagaacatcatagggaacattcgaccggat
ttcgtcgctcggtgttggccagacgggaacatcgtgtgggcgtctgcaggggtgccgaag
tgctcgggcgcgaacgacgacgtccagcaaggacgtaggagctttccgagtgggcacacg
tctatgtcgttcagcggtttgttttactgctcgctctacctcgccgcttggttcagagtc
ggacgagaagagcgtaaatttagaaggtgggaggctgtgtggaaattaatcgtggttctg
ggaccgactttgctcgctatgttcgtgggtttgacgaggatccgcgattactggcatcac
tgggaggacgtccttgtcggtgcgacgctcggaacgaccttcgcttacgtgtcatgggtg
tacaagaagccgtatgtgcgaccatctggattcggatttaacgagaactatacaccgttg
ggacgaagcgccgaggatttttctctggtagactga

DBGET integrated database retrieval system