KEGG   Ostreococcus tauri: Ot03g02120Help
Entry
Ot03g02120        CDS       T01358                                 

Definition
putative phosphatidic acid phosphatase (ISS)
Organism
ota  Ostreococcus tauri
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BOGAS: 
UniProt: 
Position
3
AA seq 291 aa AA seqDB search
MASSSGERGETAREAREEREETSNLMTRRARARTLAVDAVAFGLMFSLGTWLEVAEPNQK
YIQQEMLWRYSYPHKENTVPTVVVPIISFLIPLACMLAVPRSWNPHVRKERAIGGLTVSV
GLTWVVTCAMKNIIGNIRPDFVARCWPDGNIVWASAGVPKCSGANDDVQQGRRSFPSGHT
SMSFSGLFYCSLYLAAWFRVGREERKFRRWEAVWKLIVVLGPTLLAMFVGLTRIRDYWHH
WEDVLVGATLGTTFAYVSWVYKKPYVRPSGFGFNENYTPLGRSAEDFSLVD
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgtcgagcggtgagcgaggcgagacggcgcgggaggcgcgggaagagcgggaa
gagacgtcgaacttgatgacgcggcgcgcgcgcgcgcggacgctggcggttgacgccgtc
gcgttcgggttgatgttctcgctcgggacgtggctcgaggtggcggaaccgaatcaaaag
tacattcagcaagagatgctgtggcggtacagttatccgcacaaggagaacacggtgccg
acggtggtggtgccgatcatctcgtttttgattccgctggcgtgcatgctcgcggttcct
aggagctggaacccacacgtgcggaaagagcgagccatcggcggcttgacggtcagcgtt
ggtcttacgtgggtggtgacgtgcgcgatgaagaacatcatagggaacattcgaccggat
ttcgtcgctcggtgttggccagacgggaacatcgtgtgggcgtctgcaggggtgccgaag
tgctcgggcgcgaacgacgacgtccagcaaggacgtaggagctttccgagtgggcacacg
tctatgtcgttcagcggtttgttttactgctcgctctacctcgccgcttggttcagagtc
ggacgagaagagcgtaaatttagaaggtgggaggctgtgtggaaattaatcgtggttctg
ggaccgactttgctcgctatgttcgtgggtttgacgaggatccgcgattactggcatcac
tgggaggacgtccttgtcggtgcgacgctcggaacgaccttcgcttacgtgtcatgggtg
tacaagaagccgtatgtgcgaccatctggattcggatttaacgagaactatacaccgttg
ggacgaagcgccgaggatttttctctggtagactga

DBGET integrated database retrieval system