KEGG   Ostreococcus tauri: Ot03g02250Help
Entry
Ot03g02250        CDS       T01358                                 

Gene name
CycH
Definition
Cyclin H (IC)
Orthology
K06634  
cyclin H
Organism
ota  Ostreococcus tauri
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:ota00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    Ot03g02250 (CycH)
  Replication and repair
   03420 Nucleotide excision repair
    Ot03g02250 (CycH)
Transcription machinery [BR:ota03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     Ot03g02250 (CycH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BOGAS: 
UniProt: 
Position
3
AA seq 322 aa AA seqDB search
MCDYASSTQREHWLHESVAQVDARRARARVETFERAKASSESSTSAMETEALTPEEERTI
VRYHEAKIQSVCGAFALPRKVKNTAVMLFKRFAVDCGTHAQSLKIMMLTSVYVACKVEES
YISAEEFCKGVREDPSRVLAAEVTFLSGLKFRLVCYGATRPLDGFLMDVEDGGCKGATSK
QLIECRKKALDIVDRLMLTDAPLIRPPGQIALCALRRAARECGASELEKYCEDVGARGTT
KAPRGAKLKEILDDIESHVDEGVEPDAAVVKEIDKKLKLWRAKYLAKTPAADDAGDAQKA
AKRRKSEQSRQDMIAAEEDALG
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgattacgcctcatcgacgcagcgcgagcactggctccatgaatccgtcgcccag
gtcgacgcgagacgcgcgcgcgcgcgcgtggagacgttcgagcgcgcgaaagcatcgagc
gagtcgtcaacctcagccatggaaaccgaagcgctgacgcccgaagaggagcgaacgatc
gtgaggtaccacgaggcgaagatacaatccgtctgcggcgcgtttgcgctgccgagaaag
gtgaagaacacggcggtgatgctgttcaagcgcttcgcggtggattgcgggacgcacgcg
caatcgctgaagatcatgatgctgacgagcgtgtacgtagcgtgtaaggtggaggagagc
tacatctcggcggaggagttctgtaagggcgtgagagaggacccgtcgcgagtgttagcg
gcggaggtgacgtttctatctggattgaagtttcggttggtgtgctacggagcgacgcgg
ccgctggacgggttcctgatggacgtcgaggacggtgggtgcaagggagcgacgtcgaaa
cagctcatcgagtgcagaaagaaagcgttagatatcgtcgatcggttgatgctgacggac
gcgccgctgattcgaccgccggggcagatcgcgctgtgcgcgcttcgtcgggccgcgcgc
gaatgcggggcgagtgaactcgaaaagtattgcgaagacgtcggcgcgcgagggacgacc
aaggcgccgcgcggagcgaaactcaaggaaatcttagacgatatcgaatcgcacgtcgac
gagggcgttgaacccgacgcggctgtcgtgaaggagattgacaaaaagctcaaactctgg
cgtgccaaatatctggctaagacgccggcagcggacgacgctggcgatgcgcagaaagct
gcgaaacgtcgaaagagcgaacaatctagacaagacatgatcgccgccgaggaggacgcg
ctcggataa

DBGET integrated database retrieval system