KEGG   Ostreococcus tauri: Ot03g03020Help
Entry
Ot03g03020        CDS       T01358                                 

Definition
Predicted esterase of the alpha-beta hydrolase superfamily (Neuropathy target esterase), contains cAMP-binding domains (ISS)
Orthology
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
ota  Ostreococcus tauri
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:ota00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Ot03g03020
Enzymes [BR:ota01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Ot03g03020
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BOGAS: 
UniProt: 
Position
3
AA seq 1102 aa AA seqDB search
MHAWTRWENAKASSSEATTVGTTRDEKNASRGGATARGVRGVGGDSAEALRPTAHGSVAS
LGGSSTSRDDEFWSADEDGGERRRRLFSVLELELSKELFEASAEERLAPNEVLFRQGDDS
SSGIYVVVEGSVGVYLQSTSGAPPVMTNILQEGESVGDVDVLDSARRSVSCIAMQGGARV
VRVSQTVFLDFVRKHPYTLQLYLQQAIARLWRVAQFSLIDFLELPRQSLRGQPAADDACS
LKDSDLRSHLKVVSEHCSVKKFLKGEVLFAEGDSTEVFYILTKGSILREAIPWPKGNGVR
GEPVRAPQLIGSAHFMTRASFRETQLAHDDCEMLVITSEVLDKLRATETEAYIVLLRQTS
ASLGVLIRNFIGFGLNRVWLKSGEHVFMVDEDATSMFVIISGRVRLHFPPQKHDDETIRE
RGRGDTIGEAPLLAHGKYSSSAVTSRDSELVRMSHGALKIITAHHSEVSSRLLEIVANKL
QLNLRSGDRSYAELVTICLIPADPETKVDEFSDALRQSLSVFGSTLLLNSSVIDEIFPDG
TTKRLDNYFYRSKLTGWMAEQEEVHRFIVLQADSRGSSWSKVCASQADCVLIVAHANREN
KVPQLYEQRLLWRSRRTARPELILIHEPGSTPTQTQVWVKSRSVQMRHHHVRLTSRDDMS
RLARHVSGHSVGVILTGGGGGGLAHLGALRALEENGIPIDCIGGTSQGTLTAGMYARTLS
SSHILPMLRNNMHALNSPRHLLTDLTLPLLSLFSGKGLNEIIKRSVGAETAIEDLWLNFF
CCSTNLNKKCLTVHTCGTLWRCIRASMTVLGLLPPVRNENGELLVDGGYLNSIPVDVMRK
EMGVETVIVVDVEDKDFSSFRDLTPHDGGMGSFGLLWDRLNPFVLTKLNNGNDRLENPSY
ADVLHALTATTMKKHLEIITREHRINMHLRPPGISSWMTHGLTYSQMDAAVRKAQAYTNK
AIVTWKKKARNERRVSENEAKKPPSELHMAAASVFGESRSESGSLSPRVSPRSSFRLDEV
SPGLPTDRTPPPVHIDVPKLDAVQASRSSSAPTSRAAHLPSSETEGTFSPSESQLVRTFT
DNVVAEKKLPSERAVFVKSTRN
NT seq 3309 nt NT seq  +upstreamnt  +downstreamnt
atgcacgcgtggacgcgatgggagaatgcgaaggcgtcgtcgtccgaggcgacgacggtt
gggacgacgcgggacgaaaagaacgcgtcgagggggggtgcgaccgcgagaggggtgcga
ggggtgggcggggactccgcggaggcgctgagaccgaccgcgcacgggtcggtggcgtcg
ttgggggggagctcgacgagccgggacgatgaattctggagcgcggatgaagacggcggc
gagcggagacggagactttttagcgtgctcgagctcgagctgtcgaaggagttgttcgag
gcgagcgcggaggagcggttggcgcccaacgaggtgctgtttaggcaaggagacgatagt
tcgagcgggatctacgtcgtcgtcgagggttcggtcggggtgtacttgcagtccacgagc
ggggcgccgccagtgatgacgaatatacttcaagagggggagtctgtgggagacgtggac
gtccttgatagcgcgcggcgaagcgtgagctgcattgcgatgcaaggcggggcgagagtc
gtgcgagtgtctcagacagtcttcttagatttcgttcgaaaacatccgtacacgctgcaa
ctttacttgcagcaagccatcgcgcgactctggcgggtggcacagttctctttgattgat
ttcctcgaactaccgcgtcagtcccttcgagggcaaccggcggctgacgatgcatgttca
ctgaaggattccgacttgcgttcgcatctcaaggtcgttagtgagcattgctcagtcaaa
aagtttctgaagggagaggtgcttttcgcggagggtgattcgaccgaggtgttttacatt
ctcacgaaaggttcaatattgcgcgaagccataccgtggccgaaaggtaacggagtccgt
ggagagcccgtcagagcgccccagctgatcggttcagcgcacttcatgacgcgtgcatct
tttagagagacgcaactcgcgcatgatgattgcgaaatgctcgtcatcacgtcagaagtt
cttgacaaacttcgcgccactgagacagaggcttacatcgtcttgctgcgtcagacgtcg
gcgtctctcggtgttctaatccgcaacttcatcggcttcggactcaatcgggtttggctg
aagagtggagagcacgttttcatggtcgacgaagacgcgacgagtatgttcgttatcatc
agtggacgggtgcgtttacattttccaccgcagaagcacgatgatgagactattcgcgag
agaggtcgtggagacacgatcggggaggctcctttgctcgctcatggaaaatactcgtcg
agcgcggtgacatcacgagactcagagctcgtgagaatgtctcacggggcgctgaagatc
ataactgctcatcacagcgaggtatccagtcgcttgcttgagattgtcgccaacaagttg
caactgaaccttcgctctggagatcggtcctacgccgagcttgtgacgatttgtctgatc
cccgctgatccagaaacgaaggtcgatgagttttcggacgcactgagacaaagtctatcg
gtctttgggtctactttgttgctgaatagctccgttatcgatgagatcttccctgacggt
acaacgaaacgtttggacaactacttttatcggtcgaagctcaccggatggatggcagaa
caagaagaagttcatcgttttatcgtgttgcaggcagactcgcgcggatcaagttggagt
aaggtgtgcgcaagtcaagcggattgcgtgctcatcgtggcacatgccaatcgtgagaac
aaggtgccacagttgtatgagcagcgattactgtggcgttctcgtcgcaccgcgcggcct
gaattgattttgattcatgagccaggaagtacaccaacccagactcaagtgtgggtaaag
agcagaagtgtacaaatgcgccatcatcacgtgcggttgacatcaagggatgatatgtca
cgactcgcaagacatgtttcaggacacagcgttggggtcatcctgacgggcggtggcggt
ggaggtttagcccatctcggagcgctgcgcgcgctcgaagagaacggcattccgatcgat
tgcatcggtggaacaagccaaggtactctcacggcaggcatgtacgccaggactctgtca
tcatcacatattcttccaatgctccggaacaatatgcatgcgttgaattctccgcgccac
ttgctcaccgatcttacgctcccactcctatcgctgttcagtggtaagggtttgaacgaa
ataatcaagagatctgtcggagcagaaaccgcgatcgaggatctttggctgaatttcttc
tgttgcagcaccaatctcaacaagaagtgcctgacggtgcacacttgcggaactctttgg
cgatgtattcgggcgtcgatgacggtgctaggactgctgccacctgtacgaaacgaaaac
ggtgagctgcttgtcgatggaggctatttgaatagtatcccagtagatgtcatgcggaag
gagatgggcgtcgaaactgtcatcgtcgtcgacgtggaagacaaggacttttccagcttt
cgggatctgacgcctcatgacggcggtatggggagctttgggctgttatgggatcgttta
aacccttttgtactaaccaagctgaacaatggtaacgatcggctcgaaaacccgtcgtac
gccgatgtgttgcacgccctgactgcaacgacaatgaaaaagcatctggaaatcatcaca
cgggaacaccgtatcaacatgcacctccgacctcctgggatatcttcatggatgactcac
ggcttgacgtattctcagatggacgcagctgtgcgcaaagctcaagcgtatacgaataaa
gccatcgtgacctggaagaaaaaagcgaggaacgagcgcagagtgtctgagaacgaggcc
aagaagccgccgtccgagctccatatggctgcagcctctgtgttcggcgagtcgagatct
gaatctgggtccctatccccccgtgtctctcctcgttcgagctttcgtctcgatgaggtc
tcaccgggcttaccgactgatcgaacgccgccgcccgttcacatcgacgttccgaaactc
gacgccgttcaggcgtcgcggtcgtcgagcgctccgacgtcgcgcgccgcccaccttccc
agctcggagaccgagggcacgttctccccctctgaatcacagctcgttcgaaccttcacc
gataacgtcgtggctgagaagaaactgccgtccgagcgcgcggtgttcgtcaagtcgacg
cgcaactga

DBGET integrated database retrieval system