KEGG   Ostreococcus tauri: Ot04g00450Help
Entry
Ot04g00450        CDS       T01358                                 

Definition
putative phosphofructokinase (ISS)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ota  Ostreococcus tauri
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ota00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ot04g00450
   01230 Biosynthesis of amino acids
    Ot04g00450
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ot04g00450
   00030 Pentose phosphate pathway
    Ot04g00450
   00051 Fructose and mannose metabolism
    Ot04g00450
   00052 Galactose metabolism
    Ot04g00450
Enzymes [BR:ota01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Ot04g00450
Protein phosphatases and associated proteins [BR:ota01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Ot04g00450
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BOGAS: 
UniProt: 
Position
4
AA seq 493 aa AA seqDB search
MRVARAPVTRPPAFGARAYASRARSKTASNATPRPDYDATTLFSPSVREIFLPEHIGEMY
NLPKRPSPFARGGALWQFGLGQRFIDNGDSVSLNPLRTTGSSGEAASEEDVAFSDERAVR
AGAREVIYYDPKKVRAAIVTCGGLCPGLNDVVRSITLTLEDYGVEDIVGIKYGFRGFFAD
PENALEAPMKLTSAIVDDIQITGGSMLGSSRGGADMPAIVQKIEEMELDFLFVIGGNGSH
AGALAIDKLCREKNLTTSVIGVPKTIDNDILLLDRTFGFQTAVDEAVKAIRSANIEARSA
DNGVGLVRLMGRQSGFIAMHAALASGNTDVCLIPEIDCPLEGSGGVLAHIVRVIERQNHA
VIVVAEGAGQEQLGMIGETDASGNPVLQNFAKYLQQKLKEAKPNVDIKYIDPTYMVRACR
TNASDAVYCSILGQNAVHAAFAGLSAVTVGMCSGHYVYLPIPPVISAPRTVDPEGRMFER
LRFAIGQPTFSKS
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtcgcgcgcgcgcccgtgacgcggccgcccgcgttcggtgcgcgcgcgtacgca
tcgcgcgcgcgctcgaagacggcgtcgaacgcgacgccgcgtcccgattacgacgcgacg
acgctcttctccccgagcgtgcgcgagattttcctccccgagcacatcggtgagatgtac
aatctgcccaagcgaccgagcccgttcgcccgcggtggcgcgctgtggcagtttggtctc
ggacagcggttcatcgataacggcgatagcgtgagcctgaacccgctgcggacgacgggg
tcgagcggcgaggcggcgagcgaggaagacgtcgcgttctcggacgagcgcgcggtgcgc
gcgggggcgagggaagtgatatactatgatccgaaaaaagtgcgggcggcgatcgtgacg
tgtggagggctgtgtccgggtctgaacgacgtcgttcggtcgatcacgctgacgttggag
gactacggagtggaggacattgtcgggatcaaatacggctttaggggattctttgccgat
ccagagaatgcgctcgaggcgccgatgaagctcacgtcggctattgtggatgacattcag
atcactggaggaagcatgctcggatcgagtcgaggcggggcggatatgccggcaattgta
caaaaaattgaagagatggagctggatttcctcttcgtcatcggcggtaacggttcgcac
gcgggcgcgctggccatcgacaagctgtgtcgagagaaaaatctcacgacgtcggtgatc
ggagtcccgaagacgattgataacgacatattgttgctcgataggactttcggtttccaa
accgccgtcgatgaagccgtcaaggccatccgctcggcgaacatcgaggcgaggagcgcg
gacaacggcgtgggattggtgcgtttgatgggtcgacaatctggttttattgccatgcac
gccgccttggcgagtgggaacacggatgtttgtctgattccggagattgactgtcctttg
gaggggagtggtggcgttttggcgcacattgtcagggtcattgagcgacaaaaccacgcc
gtgatcgtcgtcgcagaaggtgccgggcaggagcagctcggtatgatcggtgagacagac
gcgagcggaaacccggtgttgcagaattttgcgaaatacctgcaacaaaagctcaaggag
gctaagccgaacgtcgacatcaagtacatcgatcccacatacatggttcgcgcgtgcagg
acaaacgcctctgacgctgtgtactgctcgattttaggtcaaaacgccgtgcacgccgcc
ttcgcaggtctcagcgccgtgaccgtcgggatgtgctctggtcactacgtctacctgccc
ataccacccgtcatctctgcgccgcgaaccgtcgatccagagggtcgcatgtttgagcgg
ttgcgtttcgcgatcgggcaaccgaccttctcgaaatcataa

DBGET integrated database retrieval system