KEGG   Ostreococcus tauri: Ot04g00450Help
Entry
Ot04g00450        CDS       T01358                                 

Definition
(RefSeq) putative phosphofructokinase (ISS)
  KO
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ota  Ostreococcus tauri
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Brite
KEGG Orthology (KO) [BR:ota00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ot04g00450
   01230 Biosynthesis of amino acids
    Ot04g00450
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ot04g00450
   00030 Pentose phosphate pathway
    Ot04g00450
   00051 Fructose and mannose metabolism
    Ot04g00450
   00052 Galactose metabolism
    Ot04g00450
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Ot04g00450
Enzymes [BR:ota01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Ot04g00450
Protein phosphatases and associated proteins [BR:ota01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Ot04g00450
Messenger RNA biogenesis [BR:ota03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Ot04g00450
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BOGAS: 
UniProt: 
Position
4
AA seq 493 aa AA seqDB search
MRVARAPVTRPPAFGARAYASRARSKTASNATPRPDYDATTLFSPSVREIFLPEHIGEMY
NLPKRPSPFARGGALWQFGLGQRFIDNGDSVSLNPLRTTGSSGEAASEEDVAFSDERAVR
AGAREVIYYDPKKVRAAIVTCGGLCPGLNDVVRSITLTLEDYGVEDIVGIKYGFRGFFAD
PENALEAPMKLTSAIVDDIQITGGSMLGSSRGGADMPAIVQKIEEMELDFLFVIGGNGSH
AGALAIDKLCREKNLTTSVIGVPKTIDNDILLLDRTFGFQTAVDEAVKAIRSANIEARSA
DNGVGLVRLMGRQSGFIAMHAALASGNTDVCLIPEIDCPLEGSGGVLAHIVRVIERQNHA
VIVVAEGAGQEQLGMIGETDASGNPVLQNFAKYLQQKLKEAKPNVDIKYIDPTYMVRACR
TNASDAVYCSILGQNAVHAAFAGLSAVTVGMCSGHYVYLPIPPVISAPRTVDPEGRMFER
LRFAIGQPTFSKS
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtcgcgcgcgcgcccgtgacgcggccgcccgcgttcggtgcgcgcgcgtacgca
tcgcgcgcgcgctcgaagacggcgtcgaacgcgacgccgcgtcccgattacgacgcgacg
acgctcttctccccgagcgtgcgcgagattttcctccccgagcacatcggtgagatgtac
aatctgcccaagcgaccgagcccgttcgcccgcggtggcgcgctgtggcagtttggtctc
ggacagcggttcatcgataacggcgatagcgtgagcctgaacccgctgcggacgacgggg
tcgagcggcgaggcggcgagcgaggaagacgtcgcgttctcggacgagcgcgcggtgcgc
gcgggggcgagggaagtgatatactatgatccgaaaaaagtgcgggcggcgatcgtgacg
tgtggagggctgtgtccgggtctgaacgacgtcgttcggtcgatcacgctgacgttggag
gactacggagtggaggacattgtcgggatcaaatacggctttaggggattctttgccgat
ccagagaatgcgctcgaggcgccgatgaagctcacgtcggctattgtggatgacattcag
atcactggaggaagcatgctcggatcgagtcgaggcggggcggatatgccggcaattgta
caaaaaattgaagagatggagctggatttcctcttcgtcatcggcggtaacggttcgcac
gcgggcgcgctggccatcgacaagctgtgtcgagagaaaaatctcacgacgtcggtgatc
ggagtcccgaagacgattgataacgacatattgttgctcgataggactttcggtttccaa
accgccgtcgatgaagccgtcaaggccatccgctcggcgaacatcgaggcgaggagcgcg
gacaacggcgtgggattggtgcgtttgatgggtcgacaatctggttttattgccatgcac
gccgccttggcgagtgggaacacggatgtttgtctgattccggagattgactgtcctttg
gaggggagtggtggcgttttggcgcacattgtcagggtcattgagcgacaaaaccacgcc
gtgatcgtcgtcgcagaaggtgccgggcaggagcagctcggtatgatcggtgagacagac
gcgagcggaaacccggtgttgcagaattttgcgaaatacctgcaacaaaagctcaaggag
gctaagccgaacgtcgacatcaagtacatcgatcccacatacatggttcgcgcgtgcagg
acaaacgcctctgacgctgtgtactgctcgattttaggtcaaaacgccgtgcacgccgcc
ttcgcaggtctcagcgccgtgaccgtcgggatgtgctctggtcactacgtctacctgccc
ataccacccgtcatctctgcgccgcgaaccgtcgatccagagggtcgcatgtttgagcgg
ttgcgtttcgcgatcgggcaaccgaccttctcgaaatcataa

DBGET integrated database retrieval system