KEGG   Ostreococcus tauri: Ot04g00450Help
Entry
Ot04g00450        CDS       T01358                                 

Definition
putative phosphofructokinase (ISS)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ota  Ostreococcus tauri
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:ota01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:ota01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ota00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:ota00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:ota00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ota00052]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BOGAS: 
UniProt: 
Position
4
AA seq 493 aa AA seqDB search
MRVARAPVTRPPAFGARAYASRARSKTASNATPRPDYDATTLFSPSVREIFLPEHIGEMY
NLPKRPSPFARGGALWQFGLGQRFIDNGDSVSLNPLRTTGSSGEAASEEDVAFSDERAVR
AGAREVIYYDPKKVRAAIVTCGGLCPGLNDVVRSITLTLEDYGVEDIVGIKYGFRGFFAD
PENALEAPMKLTSAIVDDIQITGGSMLGSSRGGADMPAIVQKIEEMELDFLFVIGGNGSH
AGALAIDKLCREKNLTTSVIGVPKTIDNDILLLDRTFGFQTAVDEAVKAIRSANIEARSA
DNGVGLVRLMGRQSGFIAMHAALASGNTDVCLIPEIDCPLEGSGGVLAHIVRVIERQNHA
VIVVAEGAGQEQLGMIGETDASGNPVLQNFAKYLQQKLKEAKPNVDIKYIDPTYMVRACR
TNASDAVYCSILGQNAVHAAFAGLSAVTVGMCSGHYVYLPIPPVISAPRTVDPEGRMFER
LRFAIGQPTFSKS
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtcgcgcgcgcgcccgtgacgcggccgcccgcgttcggtgcgcgcgcgtacgca
tcgcgcgcgcgctcgaagacggcgtcgaacgcgacgccgcgtcccgattacgacgcgacg
acgctcttctccccgagcgtgcgcgagattttcctccccgagcacatcggtgagatgtac
aatctgcccaagcgaccgagcccgttcgcccgcggtggcgcgctgtggcagtttggtctc
ggacagcggttcatcgataacggcgatagcgtgagcctgaacccgctgcggacgacgggg
tcgagcggcgaggcggcgagcgaggaagacgtcgcgttctcggacgagcgcgcggtgcgc
gcgggggcgagggaagtgatatactatgatccgaaaaaagtgcgggcggcgatcgtgacg
tgtggagggctgtgtccgggtctgaacgacgtcgttcggtcgatcacgctgacgttggag
gactacggagtggaggacattgtcgggatcaaatacggctttaggggattctttgccgat
ccagagaatgcgctcgaggcgccgatgaagctcacgtcggctattgtggatgacattcag
atcactggaggaagcatgctcggatcgagtcgaggcggggcggatatgccggcaattgta
caaaaaattgaagagatggagctggatttcctcttcgtcatcggcggtaacggttcgcac
gcgggcgcgctggccatcgacaagctgtgtcgagagaaaaatctcacgacgtcggtgatc
ggagtcccgaagacgattgataacgacatattgttgctcgataggactttcggtttccaa
accgccgtcgatgaagccgtcaaggccatccgctcggcgaacatcgaggcgaggagcgcg
gacaacggcgtgggattggtgcgtttgatgggtcgacaatctggttttattgccatgcac
gccgccttggcgagtgggaacacggatgtttgtctgattccggagattgactgtcctttg
gaggggagtggtggcgttttggcgcacattgtcagggtcattgagcgacaaaaccacgcc
gtgatcgtcgtcgcagaaggtgccgggcaggagcagctcggtatgatcggtgagacagac
gcgagcggaaacccggtgttgcagaattttgcgaaatacctgcaacaaaagctcaaggag
gctaagccgaacgtcgacatcaagtacatcgatcccacatacatggttcgcgcgtgcagg
acaaacgcctctgacgctgtgtactgctcgattttaggtcaaaacgccgtgcacgccgcc
ttcgcaggtctcagcgccgtgaccgtcgggatgtgctctggtcactacgtctacctgccc
ataccacccgtcatctctgcgccgcgaaccgtcgatccagagggtcgcatgtttgagcgg
ttgcgtttcgcgatcgggcaaccgaccttctcgaaatcataa

DBGET integrated database retrieval system