KEGG   Ostreococcus tauri: Ot04g03660Help
Entry
Ot04g03660        CDS       T01358                                 

Definition
CREB binding protein/P300 and related TAZ Zn-finger proteins (ISS)
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
ota  Ostreococcus tauri
Brite
Enzymes [BR:ota01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Ot04g03660
Transcription factors [BR:ota03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    Ot04g03660
Mitochondrial biogenesis [BR:ota03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    Ot04g03660
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BOGAS: 
UniProt: 
Position
4
AA seq 760 aa AA seqDB search
MAQQAAMRHGGQGNVTNWRDISDEQLRKAYIVKQQRWLLFLRHASKCQARHGECPYTPHC
HVAKQLWEHVLKCTLPQCNYPRCLASRELLKHHQTCKDARCPVCGPVRNAMLKQRQQAEM
AHGNKRMKLDDDPHRGQQVVKGSSGLNKDRKPGGEGTSLMECFTPEEIRVHLSSLRLADK
EKIQGQGQPSARQLHKEAERAVLNAESACRACGVERLTFEPPPLYCYSCVTRIKRGQVYH
HAPTLGGETRRDAWCNPCFNGIQGFVDVEGQRFPKQALIKKKNDDDLEEPWVQCDYCEDW
YHQICVLFNGRRNEGGEAPFTCPNCILSQLEKDERQVTKERPSSQQPANSLPKTKMSNFL
EERLATVLANEREARSKQLGVPIDNVPTAEGLTIRVVSQTMKQMDTRSHYYSHFKGEGIP
MHLAYRSRVILLFQNLEAVDVCLMAIYVQEYDDECPEPNKRRIYLSYLDSVKYFRPDNVT
VATGESCALRTYVYHNILVAYLDYAKARGFTSCFIWACPPFQGDDYILYCHPKVQKTPKA
DKLREWYMKMLRSAQQDGIVLSTSNVYDEFRLGNQNHDIRNATEYPYFDGDYFSGIVEDW
IPTIMKELEEAKNIEAKTKSSTVKISARKAAKAKSGLLSADAELNKELMKKLGSTISNMR
NDFILAHMAHQCLSCRKYIAGATRHFATEGTPLVLCQDCKDFEDALPEHERRYTGRKLSS
EERRRKSWKASSLTRVKPSCPCAKAITSNSTLFVVPSTRR
NT seq 2283 nt NT seq  +upstreamnt  +downstreamnt
atggctcagcaagctgcgatgagacacggtggacagggtaatgtgacgaactggcgcgat
atcagcgacgaacagttgcgtaaggcgtacatcgtcaagcagcagcgatggctgctgttt
cttcgtcacgcgagcaagtgccaagctaggcacggtgagtgcccatacactccgcactgt
cacgtggcgaagcagctatgggaacacgtgttgaagtgtactctgccgcaatgcaattat
ccccgttgtctagcatcacgagagctcctcaagcatcaccaaacgtgcaaggatgccagg
tgtccagtgtgtggaccggttcgcaacgccatgctcaagcaacgacagcaagctgaaatg
gcgcacggtaacaagcgcatgaagttggatgatgatccgcacagagggcaacaagtggtg
aaggggtcgagtggtttgaacaaggatcgcaagcctggtggagaaggcacctccttgatg
gagtgcttcactccagaagagattcgtgtgcacctctcttcgctgcgccttgctgacaag
gaaaagattcaagggcaagggcaaccaagcgctcgccaacttcacaaggaagccgagcga
gccgtgctcaatgccgagagtgcttgtcgtgcctgtggtgtcgaacgcttgacgtttgaa
ccgccgccgctttactgctacagttgcgtcacgcgcatcaagcgtggacaagtataccat
catgcgcccaccctcggaggcgaaaccagacgagacgcgtggtgtaatccgtgcttcaac
gggattcaaggtttcgtcgacgtcgagggccagcgcttcccgaagcaagctctcatcaag
aagaagaacgacgacgacttggaggagccctgggtgcagtgcgactactgcgaagattgg
tatcatcaaatctgtgtcttattcaatggacgtcgtaacgaaggcggtgaggccccgttt
acgtgcccgaactgtattttgtcgcagttggaaaaggatgagcgtcaagtcacgaaagag
cgtccttcgtctcagcaaccggcgaactcgctcccgaagacgaagatgtccaactttctg
gaagagcgactcgcaacggtgctcgcgaacgagcgcgaagcgcgctcgaagcagttgggt
gttcctattgataatgttcccaccgcggaaggcttgacgatccgcgtcgtctctcagacg
atgaagcagatggataccaggtcacattactactcgcacttcaagggtgaagggatccca
atgcatttagcgtatcgctctcgcgtcattctcttgttccagaaccttgaggctgtggat
gtttgtctgatggctatttatgtgcaggaatacgatgacgaatgccccgagccgaacaag
cgaaggatttacctttcttatttggactctgtcaagtatttccgacccgataacgtcaca
gtcgcgacgggagaaagttgtgctctgcgcacgtacgtgtatcacaacattctggtcgcg
tacttggactacgccaaggcgcgtggattcacttcttgcttcatttgggcttgccctccg
ttccagggtgacgactacatcttgtactgccatcctaaggttcaaaagacgccgaaggct
gacaagctgcgagagtggtatatgaagatgttgcgctctgctcaacaagatggaattgtc
ctgtccacttccaacgtatacgacgaattcaggcttggcaaccaaaatcacgacatcagg
aacgctacagaatacccatacttcgatggtgattatttctccggtatcgttgaggactgg
atcccgaccatcatgaaggagctcgaagaagcgaagaacatcgaagcaaagacgaagtcg
tcgaccgtgaagatcagcgctcgtaaggccgctaaggcgaagagtggtcttctctccgcg
gatgccgagctgaacaaggagctcatgaagaagcttggttcgacgattagtaacatgcgg
aacgattttatcctcgctcacatggctcaccagtgcttgagctgccgcaaatacatcgcc
ggcgccacgcgacacttcgccactgagggaacgcctctggtgttgtgccaagactgcaag
gacttcgaagacgctttacccgagcacgaaagacgctacaccgggcgcaagctcagcagt
gaagaaaggaggaggaaaagttggaaagcgagttctttgacacgcgtcaagccttcttgt
ccttgtgccaaggcaatcacttccaattcgactctcttcgtcgtgccaagcacacgacga
tga

DBGET integrated database retrieval system