KEGG   Ostreococcus tauri: Ot04g04050Help
Entry
Ot04g04050        CDS       T01358                                 

Definition
MAPKK (ISS)
Orthology
K04368  
mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
ota  Ostreococcus tauri
Brite
Enzymes [BR:ota01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     Ot04g04050
Protein kinases [BR:ota01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   Ot04g04050
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BOGAS: 
Position
4
AA seq 310 aa AA seqDB search
XSECGERDGFILGAADLELVGVIGTGSGGVVRLATHKRTGEALAVKTIAISLARDENERK
RIVTELRTLHKSECDYIVRSSGAYFDRGSVSLVMEYMDGGTMSDATKYLGKWVEQDLAAA
TSMLADGLHYLHTKLNVVHRDIKPCNVLLNLRGEAKLSDFGVSGHLTDASKCHSWVGTVT
YMSPERIQGESYEYTADVWSFALTMVECALGRFPYNPPDVSRRLVFWDLLDIVVQDPVPN
LRPELDVSDEFDNFVALGLNKDPTGRMLTKNMIAHPWIFGRDRASDKRRIAALAARHLDA
RSKARERGEK
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
nngagcgagtgcggggagagagatgggttcattttgggcgcggcggatctggagttggtg
ggggtgatcggaactgggagcggcggcgtcgtgcgcttggcgacgcataagcgcacgggc
gaggcgttggcggtgaagacgattgcgatttcgctggcgagggacgagaatgaacggaag
cggatcgtcaccgaactgcgaacgctgcataagagcgagtgcgattacatcgtgcgaagc
tcgggggcgtacttcgatcgggggagcgtgagtttggtgatggagtacatggacggcggg
acgatgagcgacgcgacgaaatatcttgggaaatgggtggaacaggatctcgccgccgcg
acgtccatgctcgccgatggtttacactatttgcacacgaaattgaatgtggtgcatcga
gacatcaagccgtgtaacgtgttgctcaatctgcgcggcgaggccaagttgagcgatttc
ggcgtcagcggacacctcaccgacgcgagtaagtgccactcgtgggtggggacggtgacg
tacatgtcgcccgaacgcattcagggcgaatcgtacgagtacaccgctgatgtgtggagt
ttcgcgctcacgatggtggagtgcgcgctcgggcgctttccgtacaatccgcccgacgtc
tcgagacgactcgtcttctgggatctcctcgatatcgtagttcaggaccccgtcccaaat
ctacgacccgagctcgacgtctcggatgaattcgacaatttcgtcgccctcgggctcaac
aaggaccccacgggtcgcatgctgacgaagaacatgatcgcgcacccatggatttttggc
cgtgaccgcgcgagcgataagcgccgcatcgccgccctcgccgcgcgccacttagatgct
cgctccaaggcgcgcgaacgaggcgagaagtaa

DBGET integrated database retrieval system