KEGG   Ostreococcus tauri: Ot04g04110Help
Entry
Ot04g04110        CDS       T01358                                 

Gene name
SBEI
Definition
Branching Enzyme I (IC)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
ota  Ostreococcus tauri
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ota00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Ot04g04110 (SBEI)
Enzymes [BR:ota01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Ot04g04110 (SBEI)
Exosome [BR:ota04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Ot04g04110 (SBEI)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BOGAS: 
UniProt: 
Position
4
AA seq 776 aa AA seqDB search
MHPSASSTVRARVTRTGGRTTRARRVFHAASPSTGAAPACPPKRSATRPRASSETEVETS
TTTARSMEAADGSEAVALDEQLAPHVEHLRYRYATFRERKSAIEAAEGSLDAFSRGYERF
GFTTDASGEITFREWAPAASHVALIGDFNDWNGDATPLRRSEFGTWEVTLPKGAIAHGSR
VKVRVYNDQGQFDRIPAWIRRATVEPGVMGAGYDGVYWAPEEKYEFKNAKPKKPVASRIY
EAHVGMSSNDPKINSYREFADDVLPRVAAGGYNTVQLMAVMEHAYYGSFGYHVTNPFAVS
SRSGTPEDLKYLVDKAHGLGVRVLLDVVHSHASSNTNDGIAGFDLGQRDVDSYFGTGEAG
YHWLWDSRLYKYDNWEVMRYLLSNLRYWVDEYNFDGFRFDGVTSMLYHHHGLQMEFSGDY
EQYFSTSTNVDGVVYLMLANELLHSLYPEIEVIAEDVSGMPTLCLPVDKGGVGFDARLAM
SIPDFWVKYLKTKPDEQWSTFEMVSTLCNRRYTEKAIAYVESHDQSIVGDKTTAFWLMDA
EMYDGMSTLNEPSVVIERGIALHKMLRLVTASLGGEGYLTFMGNEFGHPEWVDFPREGNG
WSHDYCRRRWDLADADHLRYQHLLNFDKGMLALDDQYSYIAAAHQHVSTADDNRQILVFE
RGPLVFVFNFHPHQTYEGLEIGVPEPGKYQLAFDTDAREFGGKSRCGFSVDHFTSPDGPE
SWVGPYEQPPRAAKMLVLSPARSAQVYFKVPEPAPSAEPSVSDIVREIDADAGAAR
NT seq 2331 nt NT seq  +upstreamnt  +downstreamnt
atgcacccatcggcgtcgtccacggtccgagcgcgcgtgacgcgcacgggcggacgcacg
acgcgcgcgcgacgcgtttttcacgcggcatcgccgtccaccggcgccgcgccagcgtgt
ccgccgaagcgatcggcgacgcgaccgcgcgcgtcgtcggagaccgaggtcgagacgtcg
acgacgacggcgcgatcgatggaggcggcggatgggagcgaagcggtggcgctggatgaa
cagctcgcgccgcacgtcgagcatttgagatatcgttacgcgacgtttcgcgaacgaaaa
tcagcgatcgaagccgcggaggggtcgctggacgcgttctccagagggtacgaacgcttc
gggttcaccacggacgcgagtggggagataacgttccgggagtgggcgcccgcggcgtcg
cacgtggcgctgatcggagactttaacgattggaacggcgacgcgacgccgctgcgtcgg
agcgagttcgggacgtgggaggtaacgctgccgaagggggcgatcgcgcacggatcgcgg
gtgaaggttcgcgtgtacaacgatcaagggcagtttgatcgcattccggcgtggattcga
agggcgacggtggagcccggggtcatgggcgccggatacgacggcgtctactgggcgccc
gaggaaaagtatgagttcaagaacgcgaagccaaagaagcccgtggcgtcgaggatttac
gaagcgcacgtgggaatgagctcgaatgatccgaagattaactcctacagggagttcgcc
gacgacgtgctcccgagagtcgccgcgggtgggtacaatacggtgcaactcatggcggtg
atggagcacgcgtattacggatccttcggttatcacgtcacgaatccgttcgcggtttcc
tcgcgtagcgggaccccggaagatttgaagtacttggtggacaaggcacacggtctgggc
gttcgagtgctcttggacgtcgtgcactcgcacgcgtcgagcaacacgaacgacggcatc
gccggtttcgacttgggacaacgcgacgtggattcctactttggcaccggtgaagccggc
taccactggctgtgggactccagattgtacaagtacgacaactgggaggtaatgcgctac
ttgctttcgaacttacgatactgggtcgacgaatacaattttgacggcttccgattcgac
ggcgtcacgtccatgttgtaccatcaccacggattacaaatggagttttccggagactac
gaacaatacttttccacgtcgacgaacgtcgacggcgtggtgtacttgatgctcgcgaac
gagttgcttcactcgttgtaccctgaaatcgaagtcatcgccgaagatgtgagcgggatg
cccacgctttgcttgccggtggataagggcggcgtcggtttcgacgctcgtctggcgatg
tccatccccgacttttgggtcaagtacctcaaaactaagccggatgagcaatggagcacg
tttgaaatggtaagcacgctgtgcaaccgtcgatacacagaaaaggcgatcgcgtatgtg
gaatcgcacgaccaatccatcgtcggcgacaagacgactgcgttttggttgatggacgcc
gagatgtatgatggtatgtccacgctgaacgaaccctccgtcgtcatcgagcgtggtatc
gctctgcacaagatgcttcgtctcgtcaccgcctctctcggcggtgagggctacctcacg
ttcatgggcaacgagttcggccatccggagtgggtggacttcccgcgagagggcaacggc
tggagccacgattactgccgtcgtcgctgggacttggcggacgccgatcacctgcgttac
caacaccttctcaacttcgacaagggcatgctcgcgctcgatgatcagtactcctacatc
gcggccgcacatcagcacgtgagcaccgccgacgacaaccgacagattctcgtctttgag
cgcggtccgctcgtcttcgtgttcaatttccatccgcaccaaacgtacgagggattggag
atcggcgtcccagagcccggaaagtaccagctcgccttcgacaccgacgcacgagagttc
ggtgggaagtcccgctgcggtttttccgtcgatcatttcacctctccggatggtcccgag
tcctgggtcggcccgtacgagcaaccgccacgcgcggcgaagatgctcgtcttatccccg
gcccgaagcgcccaggtctacttcaaggttcccgagcccgcaccatcggccgaaccctcc
gtgagcgacatcgttcgcgagatcgacgccgacgccggcgccgcgcgatag

DBGET integrated database retrieval system