KEGG   Ostreococcus tauri: Ot04g04510Help
Entry
Ot04g04510        CDS       T01358                                 

Definition
ubiquitin specific protease 5 (ISS)
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]
Organism
ota  Ostreococcus tauri
Brite
Enzymes [BR:ota01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     Ot04g04510
Peptidases [BR:ota01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Ot04g04510
Exosome [BR:ota04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Ot04g04510
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BOGAS: 
UniProt: 
Position
4
AA seq 649 aa AA seqDB search
MAGDSRGIEKIPSDPSKWRCEETGESGNLWVNLSDGHIGSGRRHFDGSGGNGSALRHYEA
MKAQGKHYPLVVKLGTISAKGADVYSYSPDEDDMVEDPYLAEHLRHWGINMVSMEKTEKS
MAELQIELNKGFEFDKITEAGSKLESAHGPRLVGLKNMGNTCYLNSVIQALKQVPAVCDR
YFDKDEIFSTAPENPVTDFPTQMSKLINALVSDEYATPEAENAAVAVCPRMFKQLVGKGH
PEFSTGGQQDAVEYFQHLLETMTRAERAAGSRLSEGPPTAAQFTFELEDKVTCVESGNVR
YSVRKDNILSLEVPLDKATNKESVDAFRERELKRAKTESDDVEEIVRPEVPFSACLEAFG
ATETIEDFYSSALKRRSIASKTTRVKTMPNFLAVQLRRYFVGEDWTPKKLDVLVDVPKTI
SLENLRAMGLQPDEIVLPEDETANTAASSAPVRVEPDAAIVSALMAMGFSENGSKRAALA
TNNASTELSMEWVFAHMEDVDFNDPLPDQSAASEPAMAASDPESVTMLTSMGFDETAANA
ALKACSGNLERAADWLFSHADDLPSAIAEVNGASTSADASEGAGSVSFDGPGEYELFGIV
SHMGGNTNCGHYVAHVEIDGKWYIFNDRKVALSLKPPTDLGYLYFFRRR
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atggcaggagactcgcgaggtatcgagaagattccgagcgatccatcgaagtggcgatgc
gaggagacgggtgagagcgggaatttgtgggtcaacctcagcgacgggcacatcggaagc
ggtcgacgccacttcgacggatccggggggaacggtagcgcgctcaggcattacgaagcg
atgaaagcgcagggaaaacattacccgttggtcgtgaagctcggcaccatcagtgcgaag
ggtgcagacgtgtactcgtactccccggacgaagacgacatggtggaggatccgtatttg
gctgagcacttgaggcactggggaattaacatggtatccatggagaagaccgaaaagagc
atggctgaattgcaaatcgagctcaacaagggctttgagttcgataagatcaccgaagcc
gggtcgaagctcgaatccgcgcacggtcctcgactcgttggtttgaagaacatggggaac
acgtgctacttgaactcggtgatacaagcgctcaagcaagtccccgcagtgtgcgatcga
tattttgacaaagatgagatcttctccaccgcgcccgagaatcccgtgacggacttcccg
acacagatgtccaaactcatcaacgctctcgtctctgacgagtatgcgactcccgaggcc
gagaacgccgccgtcgctgtttgtccgagaatgttcaaacagctcgtcggtaagggccat
cccgagtttagcacgggtggtcaacaagatgcggttgagtacttccaacacttactcgag
acgatgacgcgagctgaacgcgcggcaggttccagactaagcgaaggcccgcccaccgcg
gcgcagttcacttttgagctcgaagacaaggtgacgtgcgtcgagagcggaaacgttcgg
tactccgttcgtaaggacaacatcttatccctcgaggtacccttggacaaggcgacgaac
aaagaatctgtcgacgcgttcagagagcgagagctcaagagggcgaagacagagtcggat
gacgtcgaggaaatcgtgcgaccggaagttccgttctctgcttgtctggaagccttcggc
gccacggaaaccatcgaagatttctacagttccgcgctcaagcgtaggtcgatagcgtcg
aagacgactcgcgttaagactatgccgaacttcctcgctgtgcagctcaggcgttacttt
gtgggcgaagactggacgccaaaaaagctcgatgtacttgtggacgtgccgaaaacgatc
tctctcgaaaacttgcgcgcaatggggttacaacccgatgagatcgtgcttccagaagac
gagacggctaacactgcggcttcatcggcaccagttcgagtcgaacccgacgcggccatc
gtgagcgctctcatggccatgggattcagcgaaaatggtagcaaacgtgccgctttggcg
acaaacaacgcttcaacggagctctcaatggaatgggtgttcgctcacatggaggatgtc
gacttcaacgatccgcttccagatcagagcgccgcttcagagccagcgatggcggcgtcg
gatccagagtctgtgaccatgctcacgtcaatgggtttcgatgaaaccgcggcaaacgcc
gcactcaaggcgtgttctgggaacttagaacgagcggcggactggcttttctcgcacgcg
gacgatcttccatctgcgatcgcagaggtgaacggtgcgtcgacgtccgctgacgcatcg
gagggagcgggtagcgtgtcctttgacggtccgggcgagtacgagctcttcggcatcgtc
agtcacatgggtggaaacactaattgcggtcactacgtcgcacacgtagagatagacgga
aagtggtacatcttcaacgatcgaaaggtagcgctgtcgctgaaaccgccgacggatctt
gggtacttgtactttttcaggcgacgttga

DBGET integrated database retrieval system