KEGG   Ostreococcus tauri: Ot05g00100Help
Entry
Ot05g00100        CDS       T01358                                 

Definition
GTP cyclohydrolase I (ISS)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
ota  Ostreococcus tauri
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ota00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Ot05g00100
Enzymes [BR:ota01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Ot05g00100
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BOGAS: 
UniProt: 
Position
5
AA seq 504 aa AA seqDB search
MPRALSECVVRTEAMAKPRARDGVETAPPSPTTPHDASFPGAASSSDSDASDGAADVSRC
VREMLRAMGEDVEREGLMDTPARVAKALAFAMRGYDACPTAALGTALFNEDGLARASSAS
TKEDVELGTNDVVLVRDIPVFSTCARTFMPFYGVIHVGYAPRAGVIVGLSKLARVAEVYS
RRLQTPDGLARAVAQALDDVASPLGVGVMFTGMQLGPFEPRKMEGWASTGCFAATNSVWW
DEFSALVELGGGPSELSRGIWGDESRCGSCDNVQGGKVATTRGETETMMDAAASRAASEV
DESVFSSVSKLLRALNLEKRVSEATDGEVTLEDTAKRYSQLLAAMRSGADVPFNLIAESA
TRDGESNDGVDEIEDGVCVTRDLHMSTVCEHHLLPFHGTVSAAYMTGPGAQPLSRDTLQA
IVSRHSRRLQVQERLTRDIAEEISTLTGGVGVIVAARASHLCMVSRGVEKPGSSTCTAVK
LGQFAREPALRARVWKRLCATGNL
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgcgcgttgagcgagtgcgtcgtgcgcacggaggcgatggcgaagccgcgcgcg
cgcgacggcgtcgaaaccgcgccgccgtcgccgacgacgccgcacgacgcatcgttccca
ggcgccgcctcgagctcggacagcgacgcgagcgatggcgcggccgacgtctcgcgatgc
gtgcgagagatgttgcgagcgatgggagaggacgtggagagagagggtttaatggacacg
cccgcgcgcgtggcgaaggcgctggcgttcgcgatgcgaggatacgacgcgtgcccgacg
gcggcgttagggacggcgctcttcaacgaggacggcttagcgcgcgcctcgagcgcgagc
acgaaggaagacgtcgaactgggaacgaacgacgtggtgttggtgagagatattcccgtt
ttcagcacgtgcgcgaggacgttcatgccgttttacggagtaattcacgtcgggtacgcc
cctcgcgcgggcgtcatcgtcggcttgagcaagctcgcgcgcgtcgcggaggtgtactcg
aggcgattgcagacccccgacgggttagcgcgcgcggtggcgcaggcgttagatgacgtc
gcgtctccgctgggggttggcgtgatgttcacgggcatgcagttgggaccgtttgaaccg
cgaaaaatggagggatgggcgtcgacggggtgcttcgccgcgacaaactccgtgtggtgg
gacgagttttcggcgctcgtagagctcggcggtggaccgtccgaactttcgcgtgggatc
tggggcgatgaatctcgctgcggctcgtgcgataacgtgcaaggtggaaaggtagcgacg
acgaggggcgagacggagacgatgatggacgccgcggcttcgcgagccgcgtcggaggtt
gacgagtccgttttctcgagcgtttccaagctccttcgggcgttgaatttagagaaacga
gtttcagaggcgaccgacggagaggtgacgctggaagacaccgcgaagaggtactcgcag
ttgctcgcggctatgcgatccggagccgacgtgcccttcaacctgatcgcggaatcagcg
acgcgagatggcgagtcgaacgacggcgtggacgaaatcgaggatggcgtgtgcgtcaca
cgcgatcttcacatgtccacggtgtgcgaacatcatctcttgccgttccatggcacggtg
agtgcggcgtatatgacgggtccgggcgcgcaaccgctcagccgcgacaccctccaggcc
atcgtcagtcgccattctagacggttgcaggtgcaagaacgactcacgcgagacatcgca
gaagagataagcaccctcacggggggcgttggagtgattgtagccgcgcgcgcctcacac
ttgtgcatggtgagccgaggagtcgagaaacccggtagctcaacgtgcacggctgtgaaa
ctcgggcagttcgcccgtgagcccgcgttgcgcgcgcgcgtttggaagcgcttatgcgct
acagggaatttataa

DBGET integrated database retrieval system