KEGG   Ostreococcus tauri: Ot05g01030Help
Entry
Ot05g01030        CDS       T01358                                 

Definition
protoporphyrin IX magnesium chelatase (ISS)
Orthology
K03403  
magnesium chelatase subunit H [EC:6.6.1.1]
Organism
ota  Ostreococcus tauri
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:ota00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BOGAS: 
UniProt: 
Position
5
AA seq 1353 aa AA seqDB search
MTSTSSRPSRARRSACARALTSDAERFAVDALERSTEVDDRAEVERAETRARELRATLDA
LQEELDETYAETFGKITLVGEDGTERAFMEEAGSERGFRELNAREPKIAAAILREAERDA
KSWLAFQKRAHALKAKRDRGRGELSDAESAIAVAKRGGVGFLSSRRCDRRRSLEKRDGVR
KIVLLSGFESFNVALYKSSARDLKKRYPHVELLVFSDRDIENKRGEVEAALDGADVFFGS
LLFDYDQVEWLRTRVEDIPLRFVFESALELMSCTSVGSFQMAAPGGQKAGPPPAVKAVLS
KFGSGKEEDKLVGYLSFLKIGPKLLKFIPGDKARDLKNWLTVYSYWNAGGKENVEEAFAF
LASEYLAPPGEEEKKTSFLSRLFTSSNAPRSPIETPALGLYHPQRERERMPYFETISSYL
DWHARTRAHKVPAGAPRVAVLLYRKHVITKQPYLADLVESFEESGVLPIPIFINGVEAHT
IVRDMLTSEHEQRMRSEGVIEVDSLKSDAAIVDAVVSTVGFPLVGGPAGSMEAGRQAEVA
QGILGAKNIPYFVAAPLLIQDIASWVRSGVGGLQSTILYALPELDGAIDTVTLGGLCGDN
IYLTRERVFALSNRLKQWHSLRNTKRDKRKLAVMMYGFPPGVGATGTAALLNVPSSLDNM
LASLRAEGYDLGDEKELPSGESIIKALRVLEENATIMAGYDGAVSALEPMIQSGELPGVR
VTGANVAPSELKKWLAFPKEWGPTEWGPIPYLPESDVLVKKMEAAWGPLENYIGLATAPG
KGSVVTGLQIGNVFFGIQPALGVEGDPMRLLFERDLTPHPQYAAYYKWLQNDFKANAVVH
FGMHGTVEWLPGSPLGNTSLSWSEQLLGAMPNVYVYAANNPSESIVAKRRGYGVIIPTTC
PRMLRELLNEYRENPAENSALRASIFDMVNAAGLDSDCPFVDAQTNEKHRMTHELSESIT
QDQFDSYASDLYTYLGVLENRLFSEGLHALGKAPTQENMAQYLKAYFDNEIDENIIDEIC
KASDEESVDAIKARLEQTFNLSVPSSVSDAMQSDSAGATVGDKVSEAVEIRDLLAMNTEE
IRXXXXXXXDSAVALSLIPLSEMNGRPRVDVFFANVVGLLDDLFVRAAEADEPIEMNFIR
KHSQEMAADGIENTTARLFSNPPGDYGSMVNERVGTSGWEDSRELGDTWASRNSYSYGKG
EERGTARPEVLQSLLRTTERVVQEIDSVEYGLTDIQEYYANTGALVAAAKAAKEDAGVKD
PSVACSIVETGFAENWVYDGAHETYVEDEAMREKLRKSNPQAFRNVIKRMLEAAGRGMWD
ADEETLQNLRDMYSDVEDEMEGVKLSTTTRRTG
NT seq 4062 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcaacctcgtctcgaccttctcgcgcgcgtcgctcggcgtgcgcgcgtgcgctg
acgtcggacgcggagcggttcgccgtggacgcgctggagcgatcgaccgaggtcgacgac
cgagcggaggtcgagcgggcggagacgcgagcgagagaactcagggcgacgctggacgcg
ctccaggaagagttggacgagacgtacgcggagacgttcggaaagattacgctcgtcggc
gaggacgggaccgagcgtgcgttcatggaagaggctggaagtgagcgtgggtttcgagag
ctgaacgctcgcgagccaaagatcgcggcggcgatcttgcgggaggcggagcgggacgcg
aagtcgtggttggcgtttcagaagcgagcgcacgcgctcaaggcgaaacgggatcgcggt
cggggcgagttatcggacgcggagagcgcgattgcggtggcaaaacgcggtggggtcggg
tttctgagctcgcgccgatgcgatcgacgaagaagcctggagaagcgggacggggtgcga
aagattgttctcctcagcggtttcgagagtttcaacgtcgcgttgtacaaatcctcggca
cgtgatctgaagaagcggtacccgcacgttgaactgttggtttttagcgatagagacatc
gagaataaacgcggtgaagtcgaggcggctttggatggcgcggatgtcttcttcggctcg
ttgctcttcgattacgatcaagtcgagtggctgcgcacgcgcgtagaggatattccgctt
cggtttgtttttgagagcgcactcgagctgatgagctgcacgtccgtcggttcgttccag
atggcggcgcccggtgggcagaaggctggacctccaccagcggtaaaagccgtgctgtcc
aagtttggaagcggcaaggaggaggacaaactcgtcggatacttgtccttcttgaagatt
ggcccgaagttgttgaagttcattcccggcgataaggcgcgagatttgaagaactggctg
acggtgtattcgtactggaacgctggaggtaaagagaacgtcgaggaggcgttcgcgttt
ctcgcttcggaatacttggctccgccaggcgaggaggagaagaagacgtcgttccttagt
cgactcttcacatcgtcaaacgcgccgaggtctccaatcgaaacaccggctctgggtctt
taccacccgcaacgtgagagagaaagaatgccgtactttgagacgatttcatcgtacctg
gattggcatgctcgaactcgtgcacacaaagttcccgcaggcgctccgcgtgttgccgta
ctgctttaccgtaagcacgtcatcacgaagcaaccttacctggcagatttagttgaatct
tttgaggaatcaggcgtacttccgattcccattttcatcaacggcgtggaggcgcacaca
atcgtccgcgatatgcttacgtctgagcacgaacaaagaatgcgatcggaaggcgtgatc
gaggtggattcgttgaaatctgatgccgccatcgtggacgccgtcgttagtactgttgga
tttcctctcgtaggtggcccggccggaagtatggaagcaggacgacaggctgaagttgcg
caaggcattctcggcgcaaagaatattccgtactttgtcgcggcgcctctgctcattcaa
gacattgcatcgtgggttcgaagcggtgttggtgggctccagagcacgattctttacgcg
cttccagagctcgacggggctatcgacacggtgactctcggtggtttatgcggtgacaac
atttacctcacgcgcgagcgtgtttttgcgctctcaaatcgtttgaaacagtggcactcg
ctacgaaacacgaaacgagacaaaagaaaacttgcggtcatgatgtacgggttcccgccc
ggtgtaggagcgacgggtactgctgctttactgaacgtaccgagctccctcgacaacatg
ctggcttctctcagagccgagggatacgatctcggcgatgagaaagagttgccctcgggt
gagtcgatcatcaaagcgctgcgtgtgcttgaagagaacgcgaccatcatggcaggttac
gacggggctgtctcggcgctggagccgatgattcagagcggtgagcttccgggcgttcga
gtgactggggccaatgtcgcgccttctgagttgaagaagtggctggcgtttcccaaagag
tggggtccgacggagtggggtccgattccatacctgcccgagtcggacgttctcgtgaag
aagatggaggccgcctggggtccgctcgagaattacatcggactcgcaacagcccctggt
aagggcagcgttgtcaccgggcttcagattggaaacgtgttctttgggattcagcccgct
ctcggcgtcgagggcgatccgatgcgtttgctcttcgagcgagatctcacgccgcacccg
caatacgccgcgtactacaaatggcttcaaaacgatttcaaagctaacgcggtggttcat
ttcggcatgcacggaacggtagagtggcttccgggatcgcctcttgggaacacgagcctt
tcgtggagcgagcagcttttgggggccatgccgaatgtgtacgtctacgcggctaacaac
ccgagcgagagcatcgtcgctaaaagacgcggttacggggtaatcattcccacaacgtgc
ccccgtatgttgcgagaactcctgaacgagtacagagaaaatccagcggagaacagcgcg
ctgcgggcgtcaattttcgacatggtgaatgcggctggcttggatagcgattgtcccttc
gtcgatgcgcaaacgaatgagaagcaccgtatgactcatgagctctccgagtcgatcacg
caagatcagttcgattcgtacgcgagtgacttgtacacgtatctcggagttttggaaaac
aggctcttcagcgaaggcttgcacgcgctcggcaaggcgccgacgcaagagaacatggcg
cagtacctcaaagcgtacttcgacaatgaaatcgacgagaatattatcgacgagatctgc
aaggctagtgacgaagaaagcgtcgatgcgatcaaggcgcgacttgagcaaacgttcaat
ctctccgtgccgtcttctgtgagtgacgcgatgcaaagcgacagcgcgggcgccaccgtt
ggagacaaagtatcggaggctgtggaaatacgcgatcttctggcgatgaatacggaagaa
atccgagnnnnnnnnnnnnnnnnnnnngactcagctgttgcgttgtcgctcatccctctg
agcgagatgaacggtcgaccgcgagtggacgtgtttttcgcaaacgtcgtcggtttgctt
gacgacctctttgtgcgcgcggctgaggctgatgaaccgatagagatgaatttcattcgc
aagcactcgcaagaaatggccgcggatggcatcgagaacacgaccgcccgactgttcagc
aacccgccaggggactacggctccatggtgaacgagcgcgtcggaactagtggatgggaa
gactcgcgcgagctcggtgacacctgggcgtcgaggaactcgtactcctatggcaaaggc
gaagaacgaggcactgcgcgtcccgaggtcttgcagtctctactgcgcacgaccgagcgc
gtcgtgcaagaaatagactctgtcgagtacggtctgacggatatccaggagtactacgcc
aacaccggcgctctcgtcgccgcggcaaaggcggcaaaggaagacgccggcgtgaaggat
ccatccgtcgcgtgttcaattgtggagaccggattcgccgagaactgggtatacgacggc
gcacacgagacgtacgtcgaagacgaggcgatgagggaaaagttacgaaaatccaatccg
caggcgttccgtaacgtcatcaagcgcatgctcgaggctgccggtcgtggaatgtgggac
gccgacgaagagacgctccaaaatttacgggacatgtacagcgacgtcgaagatgaaatg
gagggcgtaaaactctccaccacgaccaggcgaaccggctga

DBGET integrated database retrieval system