KEGG   Ostreococcus tauri: Ot05g02300Help
Entry
Ot05g02300        CDS       T01358                                 

Definition
p21-activated serine/threonine protein kinase (ISS)
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
ota  Ostreococcus tauri
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BOGAS: 
UniProt: 
Position
5
AA seq 958 aa AA seqDB search
MASRARARRRLLEEYRAATSAEESRRAREERDALVEPVRENMERPEAWLMFLESEEALYV
GAEPTTELGKPSAATGSRNGVSLHRLYELATKTIPRRGNVNDENYVRIWLGLARQQMLSN
MDDARDTFKFLKSCGIGHKHAIYWCEWAAFGFTFKGREKAVKILKRGLDSRAEPRGAIEC
FLADIEGQRYEPVQHTQHTPFPSLAPQYTSAIKPVKPRHANEMEDDTRAAPKAPVVATPG
NLSKRAAALANFQATPTAKFTAPTHQAPTHQAAGTAYVTSSTTMPGSVSSYHSARTNGFR
GAGEKTENSMPPPSSSGMDATVTLRSRLAEAKEKYSAMSASRALVAERTPSAAEHTPMDP
PRGAPSRPRATEHTPATGGERRVESGAMASADKHPNRPREDDNTVFVNGVKYTKLECVGQ
GGTCKVFKVVSPKRKILALKRIRLDGKENETVAGFIDEIKLLKTLRGRDNIIQLIDAEVC
PREKLIFMVLEFGEIDLAHMLAKREKQRENNGGGGIDDNFLRLYFEQMVEAVNTIHEERI
VHSDLKPANFLFVEGALKLIDFGIARAIQTEQAPDHTNIVRDHQVGTVNYMSPEAILNGQ
ASALGGPMKVGRSSDIWSLGCILYQMVYGHTPFSKITGMIQKLHAITDPRHAISFPPLPV
DNPALIDLMRRCLERDPRKRISVKEILSHKFLRPVADLASPASADAGLSMTQLADLLAQI
QKYGANVDVGAVTTEVFRQISAGEPVALSPIVRRHSRLARYGDENVAPSVSYARTRPRAT
HHRSRLSWRTSSSCQAPDARRRCSRNIVRDVRVTTPAMPDPHLCRQKIWIPHCEDVLKCD
EESIVVGHSSGAVCALRLAERRRLRAIVLVAGYDDDLGDANERASGFFDSAFDYEKIKEN
CSGRIDCVIGLRDGLVPAEMQRELASKLGVREPTICEKRDHFFTPPAEEIIESIKRFV
NT seq 2877 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgcgggcgcgggcgcggagacggttgctggaggagtaccgcgcggcgacgagc
gcggaggagtcgagacgggcgagggaggagcgagacgcgctggtggagccggtgcgagag
aatatggagcgcccggaggcgtggttgatgttcttggagagcgaggaggcgttgtacgtg
ggggcggaaccgacgacggagctcggaaagccgagcgcggcgaccgggagtcgaaacggc
gtgagtttgcatcgcctgtacgaactcgcgacgaaaacgattccgagacgagggaacgtg
aacgatgagaactatgtgcgaatatggctcgggctggcgaggcaacagatgctgagcaac
atggacgacgcgagggacacgtttaaatttttaaagtcgtgcggcatcggacacaagcac
gcaatttattggtgcgagtgggcggcgttcgggttcacgttcaaggggcgggaaaaggct
gtgaagattttgaagcgcgggctggactccagggcggagccgagaggtgccatcgagtgt
ttcctcgccgatatcgaggggcagcggtacgagccggtgcaacacacccagcacacgccg
tttccatcgctcgcgccgcagtacacgtccgccatcaaacccgtgaaaccgcgtcacgca
aacgagatggaagatgacacgagagccgcgcctaaggcgcccgtcgtggcgacgcctgga
aatctatccaaacgcgccgcggcgttggcaaactttcaagcgacgccgacggcgaaattc
accgcgccgacgcatcaggcaccgacgcatcaggccgctggaaccgcgtacgtcacttcg
tcgacaaccatgcctggaagcgtgagcagctatcacagcgcgcggactaatggttttcga
ggcgctggagagaagacggagaattcaatgccgcctccatcctcgagtggaatggacgcc
acggtgacgctacgaagtagactggctgaggccaaggagaagtacagcgccatgagcgcg
tccagagcgctggtagctgagcgtacaccgtccgcggccgagcacacgccgatggatccg
ccgaggggggcaccatctcgaccgcgagcgacagagcacactcccgcaactggcggcgag
cggcgcgtcgagagcggcgccatggcgagcgcggataagcatccgaaccgtccacgtgag
gatgacaacacggtcttcgtgaatggggtcaaatacacgaagctcgagtgcgttggacaa
ggggggacatgtaaggttttcaaggtggtttctccgaagcggaaaattttggctctcaaa
cgtattcgtctggatggcaaggagaacgagaccgtcgcggggtttatcgatgagatcaag
ctactgaaaacgttgcgaggtcgggataatatcattcagctcatcgatgcggaggtttgc
ccgcgggagaagctcatcttcatggtgctagagttcggcgaaattgatctcgctcacatg
ctcgccaaacgcgagaaacagcgcgagaacaacggcggcggaggtatcgacgacaacttc
ttgcgcttgtactttgagcaaatggtcgaggccgttaatacaattcatgaagagcgcatc
gtgcacagtgatcttaagcctgcgaacttcttgttcgttgagggcgcgctcaagttgatc
gatttcggcatcgcgcgagccatccagactgagcaagctccggatcataccaacatcgtg
cgcgaccatcaggttgggacagttaattatatgtcaccggaggctatcttgaacgggcaa
gcgtccgcgttaggcgggccgatgaaggttggacgctcgagcgacatatggagtctcggc
tgcattctgtaccagatggtttatggacacacaccgttcagcaaaatcacggggatgatt
caaaagctccacgccatcaccgatcctcgtcacgccatctcgttcccgcctctgccggtt
gataatccagcgcttattgacctcatgcgtcgatgcctggagcgagatccgaggaagcgg
atatccgtcaaggagatcctctcacacaaatttctgcgacccgtcgccgacttggcttcc
ccggcttcggccgacgcggggctgtcgatgacccagctcgccgacctcttggcccagatc
cagaaatacggcgccaacgtcgatgtcggtgccgtcacgacggaggttttccgacagatc
tccgccggcgagcccgtggcgctctcaccgatcgttcgccggcactcacgcttggcacgg
tacggcgacgaaaacgtcgcgccgtcagttagttacgcccgcactcgcccgcgcgccacg
caccaccgctcgcgactgtcatggcgaacgtcgtcatcttgccaggctccggatgcgcgc
cgacgatgcagtcgaaacatcgtgcgcgacgttcgagtcacgacgccggcaatgccggac
ccacatctgtgcagacagaaaatttggatcccacactgcgaagacgtcctaaagtgcgac
gaagaatcgatcgtcgtcgggcacagctcgggagcggtgtgtgcgctccgattggcggag
cgaaggaggctcagggcgatcgttttggtcgccgggtacgacgacgacttgggcgacgcc
aacgagcgggcgtcgggtttttttgacagcgcattcgattacgaaaagatcaaggagaac
tgcagcggaaggatcgattgcgttatcgggctgagggacggattagttccggcggagatg
cagagagagttggcaagtaagctcggtgtgcgcgagccgacgatttgcgagaagcgagac
cacttcttcacgccccctgctgaggagattatcgagtcgatcaagcgtttcgtgtga

DBGET integrated database retrieval system