KEGG   Ostreococcus tauri: Ot05g02510Help
Entry
Ot05g02510        CDS       T01358                                 

Definition
Ubiquitin C-terminal hydrolase UCHL1 (ISS)
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
ota  Ostreococcus tauri
Brite
Enzymes [BR:ota01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Ot05g02510
Peptidases [BR:ota01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   Ot05g02510
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BOGAS: 
UniProt: 
Position
5
AA seq 318 aa AA seqDB search
MEWTTIESDPGVFTELARAIGVRGVAFEELYTLEADELKRLEPIYGLIFLFKYRGDDGGE
VCAIDAEAESKGVFFARQMIQNACATQAVLSVLLNADDKLELGETLSAFKEFTSEFDAET
KGLAISNSDVIRDAHNSFARPEPIVLQSRPAREDDDVFHFVGYVPKGKVVYELDGLRQGP
INHGHFGNEDDDKTWLDVAVPAIQRRIAAYSTNEIKFNLLAVTKDQRISLRERIAELQGI
GDSIGDSLAKEITQLSSELAYLESKAEDWRNENIRRRWNYLPFIFGLLREVAAKKQLMSA
FEIAKKNREKGASDGQTH
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atggagtggactacgatagagagcgatcccggggtgttcaccgaactcgcgcgtgccatc
ggcgtgcgcggtgtagcctttgaggagctctacacgctcgaagctgacgaactcaagaga
ctcgaaccaatttacggtttaattttcctcttcaagtatcgcggcgacgacggcggcgag
gtgtgcgcgatcgacgcagaggcggaatcaaagggagtcttcttcgcccggcagatgatc
caaaacgcgtgcgcgacgcaggcggtgctgagtgtcctgttgaacgcggacgacaagttg
gagctcggcgagacgctgagcgctttcaaagagttcacatccgaattcgacgcggagacg
aaagggctcgctatttcgaattcagatgtgatccgggatgcacacaactcgttcgctcgc
ccggaaccaatcgtgttgcaatccagacccgcgagggaagacgacgacgtttttcacttc
gtcggttacgtgccgaaggggaaggtggtgtatgaactcgacgggcttcgacaaggaccg
atcaaccatggacatttcggaaatgaagatgatgataaaacttggttggacgtggcagtg
cccgcgattcagagaagaatcgcggcgtattcgacgaatgagatcaagtttaatctcctg
gcggttacaaaggatcaacggatatcgcttcgagaacgaatagcagagctccaaggaatc
ggcgacagtattggcgatagtctcgcgaaagaaattacacaacttagctcagaactagcg
tatttagagtcgaaagcggaagactggcggaatgaaaacattcgtcggagatggaactac
ctgccgttcatctttggcctcctacgagaggtagccgccaagaagcagctcatgtcggcg
ttcgagatcgcgaaaaaaaatcgcgagaaaggtgcgtctgacggacaaactcattga

DBGET integrated database retrieval system