KEGG   Ostreococcus tauri: Ot05g02760Help
Entry
Ot05g02760        CDS       T01358                                 

Definition
Thioredoxin/protein disulfide isomerase (ISS)
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
ota  Ostreococcus tauri
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ota00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Ot05g02760
Enzymes [BR:ota01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Ot05g02760
Exosome [BR:ota04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   Ot05g02760
  Exosomal proteins of colorectal cancer cells
   Ot05g02760
  Exosomal proteins of bladder cancer cells
   Ot05g02760
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BOGAS: 
UniProt: 
Position
5
AA seq 515 aa AA seqDB search
MAAAHSSRSTATRAALALVAIVALVAGANALENPFARRASGGTINRDQEVIAEALTDEHV
VKLDAKAFDGEIKKSRYNFVMFYAPWDGHSKAFMPRWLSYARTHQMAGTEVTFGLVDATR
EKELDARFEIEEYPTLVLFRDGVPKTYIGDRSPEHLDKFVRRNLLKPARFLEGTDDVEVF
LIGRAVSVIGFFDDPSHLETYHHAAAEFDLDFGETKSKIATEDWKAPFPTIKMWRDFAKE
PATYDGDVKDLDAIKLWIATEMVPPVVKFSDKKLLDRLFQGPIAVNIFVFLPEERETAEK
MSIALENAAERLRGKVHIITVDAKEKIMHDYFTLHQHSGPQIRLLSHDLKYAYRGSFEID
KISKDIEEFYNEFKAGKLVPMFKSQDPLPKDGDVVQIVGKTFEKLVIDNDKHVLVWFYAP
WCRTCKAMKPVWEKLGTLYKNEKEIIIAKMDATKNEAKNVHVRHYPTVYYYHAGDKPRHE
EYDGAMEPDAIIDFLKERTGKSPHKTRRRTPHMEL
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atggcagccgcgcactcgtcgcgatcgaccgcgacgcgcgcggcgctggcgctcgtcgcg
atcgtcgcgctcgtcgcgggggcgaacgcgctggagaatccgttcgcgagacgcgcgagc
ggtggaacgatcaatcgcgaccaagaggtgatcgcggaggccctgacggacgaacacgtg
gtgaaactcgacgcgaaggctttcgatggtgagataaagaagagtcgatataattttgtg
atgttttacgcgccgtgggacgggcactcgaaggcgttcatgccgagatggctgtcgtac
gcgcggacgcatcaaatggcgggcacggaggtgacgttcgggttggtggacgcgacgcgc
gagaaggaactggatgcgcgattcgagattgaggagtatccgacgctggtgttgttccga
gacggggtgccgaagacgtacatcggtgatcgatcgccggaacacttggataagtttgtg
cggaggaatctgctcaagccggcgagatttttggaaggcacggatgacgtggaggttttt
ctcatcggtcgagcggtgagcgtgattggattttttgatgatccctcgcacttggagacg
tatcaccacgccgcggctgagtttgatctcgatttcggggagacgaagagcaaaatcgcg
acggaggactggaaggcgccgttccccacgatcaagatgtggcgagacttcgctaaagag
ccggcgacgtacgacggtgacgtgaaggatctggacgcgattaagctttggatcgccact
gagatggtgccaccggtcgtcaagttttcggacaagaagttgctcgatcgcttgttccaa
ggacccattgcagtgaacatcttcgtcttcttgccggaagaacgtgagacggcggagaag
atgtccatcgctctagaaaacgccgccgaacgacttcgtggcaaggttcacatcattacc
gtcgatgcgaaagaaaaaatcatgcacgactacttcactctccaccaacactctgggccg
cagattcgtctcttatcgcacgatctcaagtacgcctaccgaggctccttcgagatcgat
aagatctcgaaggacatcgaggaattctataacgagttcaaagcgggaaagctcgtgccg
atgttcaagtcgcaagatccactcccaaaggacggtgacgtcgtgcagattgtcggaaag
acgttcgagaagttggtcatcgacaacgacaagcacgtcctggtgtggttctacgcgccg
tggtgccgtacgtgcaaggcgatgaaaccagtctgggaaaaacttggcacgctctacaag
aatgagaaagaaattatcatagccaagatggacgcgacgaaaaatgaggcgaagaacgtt
cacgtgcgacactacccgacggtgtactattatcacgcgggcgacaagcccagacacgag
gaatatgacggcgcgatggagcccgacgcgattatcgactttctcaaagagcgcaccggg
aagtcgccgcataaaactcgcaggcgcacaccccacatggaactgtga

DBGET integrated database retrieval system