KEGG   Ostreococcus tauri: Ot05g02760Help
Entry
Ot05g02760        CDS       T01358                                 

Definition
Thioredoxin/protein disulfide isomerase (ISS)
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
ota  Ostreococcus tauri
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:ota04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BOGAS: 
UniProt: 
Position
5
AA seq 515 aa AA seqDB search
MAAAHSSRSTATRAALALVAIVALVAGANALENPFARRASGGTINRDQEVIAEALTDEHV
VKLDAKAFDGEIKKSRYNFVMFYAPWDGHSKAFMPRWLSYARTHQMAGTEVTFGLVDATR
EKELDARFEIEEYPTLVLFRDGVPKTYIGDRSPEHLDKFVRRNLLKPARFLEGTDDVEVF
LIGRAVSVIGFFDDPSHLETYHHAAAEFDLDFGETKSKIATEDWKAPFPTIKMWRDFAKE
PATYDGDVKDLDAIKLWIATEMVPPVVKFSDKKLLDRLFQGPIAVNIFVFLPEERETAEK
MSIALENAAERLRGKVHIITVDAKEKIMHDYFTLHQHSGPQIRLLSHDLKYAYRGSFEID
KISKDIEEFYNEFKAGKLVPMFKSQDPLPKDGDVVQIVGKTFEKLVIDNDKHVLVWFYAP
WCRTCKAMKPVWEKLGTLYKNEKEIIIAKMDATKNEAKNVHVRHYPTVYYYHAGDKPRHE
EYDGAMEPDAIIDFLKERTGKSPHKTRRRTPHMEL
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atggcagccgcgcactcgtcgcgatcgaccgcgacgcgcgcggcgctggcgctcgtcgcg
atcgtcgcgctcgtcgcgggggcgaacgcgctggagaatccgttcgcgagacgcgcgagc
ggtggaacgatcaatcgcgaccaagaggtgatcgcggaggccctgacggacgaacacgtg
gtgaaactcgacgcgaaggctttcgatggtgagataaagaagagtcgatataattttgtg
atgttttacgcgccgtgggacgggcactcgaaggcgttcatgccgagatggctgtcgtac
gcgcggacgcatcaaatggcgggcacggaggtgacgttcgggttggtggacgcgacgcgc
gagaaggaactggatgcgcgattcgagattgaggagtatccgacgctggtgttgttccga
gacggggtgccgaagacgtacatcggtgatcgatcgccggaacacttggataagtttgtg
cggaggaatctgctcaagccggcgagatttttggaaggcacggatgacgtggaggttttt
ctcatcggtcgagcggtgagcgtgattggattttttgatgatccctcgcacttggagacg
tatcaccacgccgcggctgagtttgatctcgatttcggggagacgaagagcaaaatcgcg
acggaggactggaaggcgccgttccccacgatcaagatgtggcgagacttcgctaaagag
ccggcgacgtacgacggtgacgtgaaggatctggacgcgattaagctttggatcgccact
gagatggtgccaccggtcgtcaagttttcggacaagaagttgctcgatcgcttgttccaa
ggacccattgcagtgaacatcttcgtcttcttgccggaagaacgtgagacggcggagaag
atgtccatcgctctagaaaacgccgccgaacgacttcgtggcaaggttcacatcattacc
gtcgatgcgaaagaaaaaatcatgcacgactacttcactctccaccaacactctgggccg
cagattcgtctcttatcgcacgatctcaagtacgcctaccgaggctccttcgagatcgat
aagatctcgaaggacatcgaggaattctataacgagttcaaagcgggaaagctcgtgccg
atgttcaagtcgcaagatccactcccaaaggacggtgacgtcgtgcagattgtcggaaag
acgttcgagaagttggtcatcgacaacgacaagcacgtcctggtgtggttctacgcgccg
tggtgccgtacgtgcaaggcgatgaaaccagtctgggaaaaacttggcacgctctacaag
aatgagaaagaaattatcatagccaagatggacgcgacgaaaaatgaggcgaagaacgtt
cacgtgcgacactacccgacggtgtactattatcacgcgggcgacaagcccagacacgag
gaatatgacggcgcgatggagcccgacgcgattatcgactttctcaaagagcgcaccggg
aagtcgccgcataaaactcgcaggcgcacaccccacatggaactgtga

DBGET integrated database retrieval system