KEGG   Ostreococcus tauri: Ot05g03030Help
Entry
Ot05g03030        CDS       T01358                                 

Definition
putative dihydrolipoamide S-acetyltransferase (ISS)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ota  Ostreococcus tauri
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ota00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ot05g03030
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ot05g03030
   00020 Citrate cycle (TCA cycle)
    Ot05g03030
   00620 Pyruvate metabolism
    Ot05g03030
Enzymes [BR:ota01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Ot05g03030
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BOGAS: 
UniProt: 
Position
5
AA seq 503 aa AA seqDB search
MKRASSRLSRSLTAIARAPSARELAQRVELSVARASVASPSTRRSSATTLAWTRKAFFAR
SWSSDALPEHVIVPMPALSPTMTRGGIASWHVEVGQAIRAGDAIADVETDKATMAMEATE
DGFMAAILVEAGAQDIEVGTPVCVTCENAEDVEAFKDYASTVAIKAESAAPVASAPSGPV
ESPSVAPVASAPSARATRAETRASGDRVFASPLAKRLAKERGVRLDNVRGTGPNGRVIAA
DVYEAHETGVNATEAAREVTVDHPLSKFFPDFEDVSVTAIKRVTAQRLTESKQQVPHFYL
TVDVRLDNMISIRQTLNKQLADDKAAEGAKISVNDFIVKASAKALLAVPEVNSSWLGDKI
RRYKKADISVAVQTERGLMVPIVRSACCLGLKTISSEVKALASRAREGSLTPQDMTGGTF
TISNLGMFGVKSFAAIVNPPQAAILAVGGARKEVIKNESGGYEEITVMSATLSCDHRVVD
GAVGAMWLQSFKGYIEDPMTMLL
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcgcgtcttcgcgcctctcgcgctcgctcaccgcgatcgcgcgcgcgcccagc
gcgcgagagctcgcccagcgcgttgaactttcagtcgctcgcgcatcggttgcatcgccg
tcgacgcgtcgttcgagcgccacgacgctcgcgtggacgcgtaaggcgttcttcgcccga
tcatggtcatccgacgcccttcccgagcacgtcatcgtgccaatgcccgcgttgtcgccg
acgatgacgcgcggcgggatcgcttcgtggcacgtcgaagtcggccaagcgatacgcgcg
ggcgacgcgatcgcggacgtcgagacggataaggcgacgatggcgatggaggcgacggaa
gatgggtttatggcggcgatattggtcgaggctggggcgcaggatatcgaggtggggacg
ccggtgtgcgtcacgtgcgagaacgcggaggacgtggaggcgttcaaggattacgcctcg
acagtggcgatcaaggcggagagcgcggcgcctgtcgcgtcggcaccgagcggaccggtc
gagagcccatcggtcgcaccggtcgcgtcggcgccgagcgcgagggcgacgcgagcggag
acgcgagcgagcggtgaccgcgtgttcgcttcgcctctggcgaaacggttagccaaggag
cgaggcgtgcgcctggataacgtgcgcgggaccgggccgaacggacgcgtgatcgcggct
gacgtgtatgaggcgcacgagaccggggtgaatgcaactgaggcggcgcgagaagttacg
gttgaccacccgctgtcaaagttcttcccagacttcgaggatgtgagcgtcaccgccatc
aagcgtgtcacggctcagcgtctgacggagagcaaacaacaggtgcctcacttctatctc
accgtagatgtgcgattggataacatgatcagcatccgtcaaacgttgaacaaacagctt
gcggacgacaaggctgcagagggggcgaagattagcgtaaacgatttcatcgtcaaggcg
agtgctaaggctctgcttgcggttccagaggtgaactctagctggctcggcgataagatc
cgtaggtataaaaaggcagatatttcggtcgcggtccaaaccgaacgcggtctcatggtg
ccaatcgtacgatcagcgtgctgtcttggtctcaagacaatcagttccgaagtcaaggcg
ctcgccagtcgcgcgcgcgaaggtagtcttacgccccaagacatgactggcggaacgttc
accattagtaatcttggcatgttcggcgtgaagagcttcgccgccatcgtaaatccgccg
caagcggctattctcgccgtcggaggcgcgagaaaggaagtgatcaagaacgagagcggc
ggatacgaggaaatcacagtcatgagcgcgacgttgagctgtgaccacagggttgtggac
ggtgccgttggcgctatgtggctgcagtcattcaagggttacatagaggatccgatgacg
atgctgctctag

DBGET integrated database retrieval system