KEGG   Ostreococcus tauri: Ot05g05120Help
Entry
Ot05g05120        CDS       T01358                                 

Definition
Mg-chelatase subunit (ISS)
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
ota  Ostreococcus tauri
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ota00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Ot05g05120
Enzymes [BR:ota01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Ot05g05120
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BOGAS: 
UniProt: 
Position
5
AA seq 756 aa AA seqDB search
MLANTARGASVRRDGVANDRAHARSGSTVTKRARRPVRVARAVTDDQESELEQRMKEVMQ
MESDSKIEKEESTMRQTFPLAAVIGQEKIKSALLLGGIDPTLGGIAISGRRGTAKSIMAR
GLHALLPPIECVKSSYCNADPTKPDEWEDGLTEEKLNRDENGNIETIIRDAPFVQLPLGV
TEDRLIGTVDIEESMKQGKTVFQPGLLAQAHRGILYVDEINLLDDGVANLLLTVLAEGEN
VVEREGITLRHPCKPLLIATFNPEEGALREHLLDRIAVTLSADQMLTFEDRVEAVNQAMN
FQNAAENSVKSVEEATEGIKTNIVLAREWLKDCTISQEQVEYLVREACRGRIQGHRAELF
AVKAAKALAALDGRSKVNADDLKEAVRLVIVPRSDILQDAPPPDEDDDQPPPPPPPPQDN
ADDEDQDEDQEDENEEEEEEEDDVPDIPEEFIFDAEGVILDKDVTQFAQQTSRQGGRSGR
SKSVIFSTDRGRYIKPILPKGKTIRLAVDATLRAAAPYQRARRERDPNAEKKKVYVEKGD
MRAKKLARKSGALVIFLVDASGSMALNRMQGAKGAALSILESSYQSRDQVSIVPFRGDEA
EVLLPPSRSIAMARNRLDSMACGGGSPLAHGLSVAARVGLNAMSTGDVGRVMIVCLTDGR
ANISINKSQRDPEYLGPDARKPTNEELEEEVNDMAARVAAAGMSLLVIDTENKFVSSGTA
EKLAQAGRGKYYYLPNGTEREIAAATAAAMQDAKTA
NT seq 2271 nt NT seq  +upstreamnt  +downstreamnt
atgctcgcgaacaccgcgcgaggcgcgagcgtacggcgcgatggcgtcgcgaacgatcgc
gcacacgcgcgctcggggtcgacggtcacaaagcgcgcgcgaaggccggtgcgcgtcgct
cgggcggtgacggacgaccaagagtccgagctcgaacaaagaatgaaagaggtgatgcag
atggagtctgattcgaagatcgaaaaggaggagagcacgatgcgacagacgttcccgctc
gccgcggtgatcgggcaagagaagattaagagcgccctactcttgggagggatcgacccc
acgctcggcgggatcgcgatctccggtcgaagaggcacggcgaagtccatcatggctcgc
ggcttgcacgcgctccttccgccgatcgagtgcgtgaagtcgtcgtactgcaacgcggac
ccgaccaagccggacgagtgggaagacgggctcacagaggaaaagctcaacagagatgag
aacgggaacatcgaaaccatcatccgcgatgcgccgttcgtgcaacttccgctcggcgtc
acggaagatcgtctcatcggtacggttgacatcgaggagtccatgaagcaaggtaagact
gttttccagccgggtctcctcgcgcaagcgcatcgagggatcttgtacgtcgacgaaatc
aaccttttggacgatggtgtcgccaacttgctcctcaccgtgctcgctgagggtgaaaac
gtggtcgagcgtgaaggtattacgctcagacacccgtgtaaaccgctcttaatcgcgact
ttcaacccggaggagggcgctcttcgcgagcaccttctcgaccgcatcgctgtgacgctt
tcggcggatcagatgttgacgttcgaggaccgcgttgaggcggtgaaccaagcgatgaac
tttcaaaatgccgccgaaaattcggtgaagagcgttgaggaagcgacggagggcattaag
accaacatcgtcctcgcgcgcgagtggttgaaggattgcaccatctcccaggagcaagtc
gagtacctcgtgcgcgaagcctgccgaggccgcatccagggccaccgcgccgagcttttc
gctgtcaaggctgcaaaggcgctcgccgcgttggatggtcgatccaaggtgaacgccgac
gacttgaaggaggctgtcagactggtcatcgtcccgagatcggacattttgcaagacgca
cctccgccggacgaggacgacgatcaaccgccgccaccgccaccgccgccacaagacaac
gcggacgatgaagatcaagacgaagatcaagaagacgagaacgaggaagaggaggaagaa
gaagatgacgttcctgacattccagaggagttcatctttgacgcagagggcgtcattttg
gataaggatgttacccagttcgcgcagcaaacatccagacaaggggggcgctctggtcga
tcgaagagcgtgatcttctccaccgatcgtggtcgctacatcaagcccatcttgccgaag
gggaagacaattcgcctggcggttgacgcgacgcttcgcgccgcggcgccgtaccagcgg
gcgcgtcgggaaagagatccaaatgcggagaagaaaaaagtgtacgttgagaagggtgac
atgcgcgcgaagaagcttgcgcgcaagtctggtgcgttggtaattttcctcgtcgacgca
tcgggctcgatggcgttgaacagaatgcaaggcgcgaagggcgcggcgctttccatcctg
gagagctcgtaccaaagccgtgaccaagtctctatcgtgccgttccgtggtgacgaggcc
gaagtgcttttgccgccgtcgcgatcgatcgctatggcgagaaatcgcctcgactccatg
gcgtgcggtggtggctctccattggcgcacggcttgtccgttgccgctcgcgtcggcctc
aacgccatgtccacgggcgacgttggacgagtgatgattgtctgccttaccgatggccgc
gcgaacatctccattaataagtcgcagagagacccggagtatctcggtccggacgcaagg
aagccgacgaacgaggagctcgaggaggaagtgaacgacatggcggcgcgcgtcgccgca
gctggcatgtcgttgctcgtcatcgacaccgagaacaagttcgtttcttccggtaccgcc
gaaaaattggctcaagcggggcgaggtaagtattactacctgccgaacggcacggagagg
gaaatcgccgcggctaccgcggctgccatgcaggatgccaagacggcgtaa

DBGET integrated database retrieval system