KEGG   Ostreococcus tauri: Ot06g00430Help
Entry
Ot06g00430        CDS       T01358                                 

Gene name
APC3/CDC27
Definition
anaphase promoting complex subunit 3 / cell division cycle prote (IC)
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
ota  Ostreococcus tauri
Pathway
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:ota00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    Ot06g00430 (APC3/CDC27)
Protein phosphatases and associated proteins [BR:ota01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     Ot06g00430 (APC3/CDC27)
Ubiquitin system [BR:ota04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     Ot06g00430 (APC3/CDC27)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BOGAS: 
Position
6
AA seq 772 aa AA seqDB search
MINRLHSSAFSRVMTSSEASGLASEIAPDLVLEATLAAAIDESLRDHRVDNALFLSERLV
ALRDAEANALLHARCLYASGKAHACTEVLGSRLTTPSARYLYARACYDLGRLAEAERALR
GDVGSGGEYVGRYGSRRRPNVAEDDAIACAGAAGEYLLGLICKDTGRRESAIARFTRALM
ADPLMWVAYEGLCALGADAEAKACASSGREDSILAMYPSLTGSSGLLACAAHGTRGEVSG
GSAPTSPSRPRMTSEDHEAATSTPATAPMREMRDVGVPPSTGASDRTRTGEVWDASNLLT
PAVGGFGDIGKAGDSVGAAARATDHGCAAHRATEHGATAHDGRRRRRNRQRADSSESDVN
SWTKASFERYRVGCLAMIPRRRPFVGVLGFKPLVRRMRRFPEDGEVSYDTSRSFGDIHDQ
GIWSWQPAASVRTGEGVLLALNMLRPIAEGLRHLTMYRCDEAIQSFQQLSKSQYNTPYVL
CAVAKAHAEMVDYSNSLKVFEEARAVAPYRLDSIDVYSTVLWHLKEEVKLAHLAQEVQAI
DRLAPQTWCVLGNCFSLQNEHETALKFFQRAIQLDPKCTYAHTLSGHEYFANEDFEKSMN
CYRAALRLDPRHYNAWYGLGTVYYRQEKYVMSEYHFRYALGINPKSSVLYCYAGMAKHAL
NETDEALALLSQAIALDAKNPLARYEMAAVLMSDENYEAALDELHKLKDIAPKEASVFFL
MGRIYKKLGIQEEAMINFSVALDLHPANTDVNSIKNAIEKLDSDDLSDEENI
NT seq 2319 nt NT seq  +upstreamnt  +downstreamnt
atgattaatcggcttcacagctcggcgttttcgcgcgtcatgacctcgagcgaggcctcg
ggtttggcctcagagatcgccccagacttggttctcgaggctacgctcgcggcggcgatc
gacgagtcgctcagagaccacagagtggacaacgcgttgtttctgtcagaacgcctcgtg
gcgctgcgcgacgccgaggcgaacgcgttgttacacgcgagatgtctgtacgcgagcggg
aaagcgcacgcgtgcaccgaggttttgggatcgaggttgaccacgccgagcgcgaggtac
ctctacgctcgggcgtgttacgatttgggacgactggcggaggcggagcgcgcgctcaga
ggcgacgtcgggagcggaggagagtacgtgggtcggtacgggtcgagacggcggccgaac
gtcgccgaagacgacgcgatcgcgtgtgcgggcgcggcgggggagtatctcttggggttg
atctgtaaggatacggggagaagagagtcggcgattgcgcggttcacgcgggcgttgatg
gctgatccgctcatgtgggtcgcgtacgaaggtctgtgcgcgctcggtgcggacgccgag
gcaaaggcgtgcgcgtcgagcggtagagaggatagtattctggccatgtatccgtcgttg
accgggagcagcggattgctcgcgtgcgcggcacacgggacgcgcggcgaggtgagcgga
ggctcggcgccaacgtcgccttcgagaccgcgcatgacgagcgaagatcacgaggcggcc
acaagcacgccggcgacggcgccgatgagagaaatgcgggacgtgggagttcctccaagc
accggggcgagcgaccgcacgcgcactggggaggtatgggatgcgtccaatttactcacg
ccggcggttggtggtttcggcgacatcggcaaagcgggcgattccgtgggcgccgcggcg
cgcgccaccgaccacgggtgcgccgcgcacagggcgaccgagcacggcgctaccgcccac
gatgggcgaagacggcggcgcaaccggcagcgtgcggactcttcggagagcgacgtaaat
tcatggacgaaggcaagcttcgaaaggtatcgggtaggttgtttagcgatgatcccgcgt
cgacggccgttcgtcggagtactaggattcaagccgctcgttcgcagaatgcggcgattc
cccgaggacggggaggtttcgtacgacacgagtcgtagtttcggagacatacatgatcaa
gggatctggagctggcaacccgcagcatctgtccgcacgggtgaaggggtgttgttggcg
ttgaacatgctaagaccgattgctgagggattgaggcacctcaccatgtatagatgcgat
gaagcgattcagtcgtttcagcagctctccaaatcgcagtacaacactccgtacgttttg
tgcgccgtggcgaaggcgcacgcggaaatggtggattactcgaactcgttgaaagttttt
gaagaagcgcgcgcggtagctccgtaccgattggattccatcgacgtgtactccaccgtg
ctctggcacctgaaggaagaggtgaaactcgcgcacttagcgcaagaggtacaggcaatt
gaccgattggcgccacagacgtggtgcgtgctcggcaattgcttctctctgcagaacgaa
cacgagactgcgctgaaatttttccagcgcgccatccagcttgatccaaagtgtacgtac
gcgcacaccctgagtgggcacgaatatttcgcgaacgaagactttgagaagagtatgaac
tgctatcgcgccgctttgcgcctagatcctagacattacaacgcttggtacggtctcggg
acggtatattaccgccaggagaagtacgtcatgagcgagtatcacttccgttacgcgctc
ggcatcaatcccaagtcgagcgtgttgtactgctacgcgggcatggctaagcacgcgtta
aacgaaaccgatgaggctttggctttgctctcgcaagccatcgcactagatgccaagaac
ccgttggctagatacgaaatggcggcggtgttgatgagcgatgaaaattatgaagcggct
ttggatgagctccacaagttgaaggatatcgcgccaaaggaggcgagcgtgttcttcttg
atgggacgaatctataaaaagctcggcattcaggaagaagcgatgatcaactttagcgtt
gccctcgatttgcatccggcaaacacggacgtcaactccattaaaaacgcgattgagaaa
ctggactcggacgatcttagcgacgaagaaaacatttag

DBGET integrated database retrieval system