KEGG   Ostreococcus tauri: Ot06g01080Help
Entry
Ot06g01080        CDS       T01358                                 

Definition
raptor1B (ISS)
Orthology
K07204  
regulatory associated protein of mTOR
Organism
ota  Ostreococcus tauri
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BOGAS: 
UniProt: 
Position
6
AA seq 1466 aa AA seqDB search
MKISPCARMQCWIQPMTTQPQNELDAIGKALQAQYERWQPRAKYKLQLDPTTEDMKKLCI
SCRRNAKNERVLLHYNGHGVPRPTANGEIWVFNKSYTQYIPLSVYDLHSWTGTPAIYVFD
CSNAGLIVKSFLKLSDPAQPQPKAGVDLEQRQSGGSMAFAQLEHGMRSGVQDSGFGPSAT
ANSANECILIAACGANELLPQSSELPADIFSACLTTPVKMALHWFCSNSVLHEHGITVDI
IDKIPGMQNNRKTPLGELNWIFTAITDTIAWNVLPRKLFQRLFRQDLLVASLFRNFLLAE
RVMRANNCTPISSPRLPPTHQHPMWAAWDMAVEQCLLQMPSLISGDPDVEFVPSPFFTDQ
LTAFEVWLEYGSEHDSPPEQLPIVLQVLLSQSHRLRALILLGRFLDLGLWAVELALSVGI
FPYVLKLLQTTAPELRQILVFIWTKILALDRSCQADLVKDDSYNYFVRFLQSSSVPVEER
AMAAFILAVICDGHEKGQSVCLASGLLNICLSNIHDAAQPETGSPFFLRWLCLCLGKLWE
ENFEAQKVACSAKAHEQLIPLFSHSSPDTRAAAVYACGTFISFGCVRESHQDDDIDRQES
HEPLMHAMSSQNVLGTKTSGSGSADTPNTVGLFISPGAIASMEITIAYQLLRTAEDASPM
VRIETAVALARIATAHSMMIRESLVAWKRDYDSVTAKRVVDAKRSEAMGVRRRFSSGTSF
SGMDHSLGSNMSTVDEDDNMPMSVESVARSADEQYATSDNTMPTTAGTLPPPFPRSHDSA
DPVESRTPEGTKGTVYTLILQALLNLATDPVPAVAKAGCHALHAADIDQSHPIMQMVTKA
GNFAEVEPVVRRLSASQRRRPSFASLDFGTHHERSFSKDVGVSPNGGGLTRTDSWHQRLA
NLGSSLGSRLLGSPTKSKPVSKLSGNRSEQQLSPSTGSVGLRTSTIRGKGRKSQALDSPV
SSAGHLPALVIPSTRTEQLRNSPTSLSTLRRTTSNLITDHSVEQDSLGQQRIFGSHASLD
SLDSTLSPRLNRSEAMHGYASDDVHDAQLPKSIIYKRSCGHFSTPLLETAQDEDDDDDDE
IESSISPWMRPPDMKRRAERLKMIRERSKETLGGGERRLKMTEYVSSIDVGGGVTPTSIL
MHPFEPHAFTGDSTGRVHIWNHNSSRMVNKIETGMKSVNLLSLVNETDDALLLTGCEDGT
VKIWRSYDSIQKETLVTAWNTLPAQPIVSENGEIRSGLPLSFYKPSTHYKAHESTQAAIV
WQQLTGCLYATGNAPNPFLRVWDVSSEICRDTLNLQAQGTCLTAEGALLMAGTHDGAVLS
YDLRAPARLLSAMQTHTTPVISILLQPGGVNNLLVTGCSEGQLKFCDLRNASKPFLITEV
THCARWSLACSSHRIWFIXXXXXXXXSERAIKLWDLRGHNFAAIQYTNSFLGQRIGSVTA
LAFHPNSAYLAAGSNAGHATIYGPHF
NT seq 4401 nt NT seq  +upstreamnt  +downstreamnt
atgaagatatcgccgtgcgcgcggatgcaatgctggattcagccgatgacgacgcagccg
cagaatgagttggacgcgatagggaaggcgctgcaggcgcagtacgagcgatggcaaccg
agggcaaagtacaagctgcagctcgatccaacgacggaggatatgaaaaagttgtgcatc
tcgtgcaggaggaacgcgaagaacgagcgcgttttgctgcactacaacggacatggcgtc
ccgagaccgacggcaaacggagagatttgggtgttcaacaagtcttacacgcagtacatt
cccttgtctgtgtatgatttacactcttggacagggacgccggcgatttacgtcttcgac
tgctccaacgccgggttaatcgttaaatctttcctgaaactatccgatccggcgcagccg
cagccgaaggcgggcgtagatttggaacaacgtcagagtggtggttcaatggcgttcgct
cagctggagcacggcatgcgatctggcgtgcaagactctggttttgggccgagcgccacg
gcaaacagtgcaaacgagtgcattttaatcgccgcctgcggcgcgaatgaactcttgccg
cagtcttcggaacttcccgcggatattttcagcgcgtgtttaacaacgcccgtgaaaatg
gccctgcattggttctgttccaactcagtattgcacgaacacgggataaccgtagatatc
atcgataaaattcccggaatgcagaacaaccgcaagacgccactcggcgagctcaactgg
atcttcacggcgatcaccgacaccatagcctggaacgtattgccacggaagttgtttcag
cgcctgtttcggcaagacttgctcgtcgcctcgctgttcagaaattttttactggccgag
cgcgtcatgcgagcaaacaattgcacgcccatttcatctcccaggttaccgcccacacat
cagcatcccatgtgggccgcttgggatatggcggtagagcaatgtctgttgcaaatgcca
tcgctgatctccggcgatcctgatgttgaattcgtcccttcgccgttcttcaccgatcag
ctcaccgcattcgaggtttggttagaatacgggagtgagcacgactctccgccagaacaa
ctaccgatcgttttacaggtgctgttatcccaatcgcatcgtttgagagcgttgattttg
ctcggacgatttttagatttagggctgtgggctgtcgaactcgcgctgtcggttggtatc
ttcccgtacgtgctgaaactacttcaaacaacggctccagagctgcgccagattttagtt
ttcatttggaccaagattctcgcactcgatcgatcgtgtcaagctgatttggtcaaggac
gatagctacaattacttcgttcgtttcttacagagctcaagcgtaccagttgaagagcgc
gctatggcggcgttcatcttggctgttatctgtgatggtcatgagaagggacaaagcgtg
tgccttgcgagcggcttgctgaacatctgtctttccaatattcacgatgctgcacaaccc
gagactggttcgccgtttttccttcgatggctgtgcctttgtcttggaaagttatgggag
gagaatttcgaggctcaaaaagttgcgtgcagcgccaaagcccacgagcagttgattccg
ctgttcagccattcttctcctgacacccgcgcggcagccgtgtacgcgtgtggaacgttt
atctcgtttggatgcgttcgtgagagtcatcaagatgacgatattgacaggcaagaatct
cacgagccgttgatgcacgccatgtcgtcacagaacgtgctcggcacaaagacctcgggt
tcaggaagcgcagacacgccgaacactgtaggtctattcatttctcctggggcaatcgcg
agcatggaaatcacaatcgcgtaccagttgcttcgaactgcggaagacgcgagtccaatg
gtcaggatcgaaacagcagtcgcccttgcccgtatagcaacagcgcactccatgatgatc
cgcgaatctttggtcgcatggaagcgcgactacgactcagtcacggcaaagcgtgtcgtc
gatgcgaaacgcagcgaggcaatgggtgtgcgtcgtagattttccagcggaacttcattc
agcgggatggaccactctctcggttccaacatgtccactgttgacgaggatgataacatg
ccaatgagcgtcgaaagcgtcgctcgctctgcagatgaacagtatgccacgagtgataac
acaatgcctactaccgctggtacgcttccacctccgtttccacgctcgcatgactcagct
gacccggtcgagtctagaacgcccgagggaaccaagggaactgtgtacacactcattctt
caggccttgctcaatctcgcgacggatccggttccagcggttgccaaggctggttgccat
gcgttacacgcagcggacatcgaccagagtcatcccatcatgcaaatggttacgaaagct
ggtaattttgccgaggttgaacctgtggtccgcaggttgtctgcgtcacagcgacgtcga
ccttcgttcgcgagtctggatttcggcacgcatcacgagcgttccttttcaaaggatgtt
ggtgtaagtccaaacggtggagggttgacacgtacggactcgtggcatcagcgcctggct
aacctcggctcttccctgggctcgcggttgctaggatcgccgaccaaatcaaagcccgtg
tccaaactgagcggcaatcgctctgagcaacagctcagcccatcaactgggtctgtgggt
ctgcgaacgtcgacaattagagggaaggggagaaaatctcaggcgctcgacagtccggtt
tctagtgccggccatcttccagcgttggtcatcccaagtacgcgcacagagcagttgcgt
aattcgccgacaagcctttcaactctgcgaagaacgacgagcaatctgatcacagatcac
agtgttgagcaggatagtttaggtcagcaacgcatttttgggtcgcatgcctcgcttgac
tcactagatagcacgctttctcctcgattaaatcgatcggaggcgatgcatggatacgca
tctgacgatgtccacgacgctcagcttccgaagagcatcatttacaagcgcagctgcggt
cacttttccacgcctttgctagagacggcgcaggacgaagacgacgatgatgacgatgag
attgaaagtagcatctcaccttggatgcgaccacccgatatgaagcgtcgcgccgagcga
ttgaagatgatacgtgagaggagcaaggagactttgggcggtggcgaacggcgactcaaa
atgaccgagtacgtgtcgagcatcgatgtgggcggtggcgtgacacctacttcgattctt
atgcacccgtttgaaccgcacgcattcactggcgacagcacggggcgggtgcacatctgg
aatcacaattcatcgcgcatggtgaataaaattgaaaccggcatgaagagcgtgaacttg
ctatcgttggtgaacgaaaccgacgacgcactcttgctgacgggatgcgaagacggcacg
gtgaaaatatggcgttcttacgattcgattcagaaagaaactctcgtcaccgcatggaat
accctgcctgcgcaaccgattgtgtccgagaacggtgagatcaggagtggattgccgctg
tcgttttacaaaccgtcgacgcactacaaggcgcacgaatccacgcaagcggcgattgtg
tggcagcagctcaccgggtgcttatacgctactgggaacgcgcccaacccgtttcttcgc
gtgtgggacgtatcaagcgagatctgccgcgatactttgaatctccaggctcagggcact
tgtctcaccgcggagggcgccttactcatggctggtacgcacgacggcgcggtgctttcg
tacgacttgagagccccagcgcgtttactaagcgcgatgcaaacgcataccacgccagtt
atatcgatccttttgcagcctggtggcgttaacaaccttctcgtgactggttgctctgaa
ggacagctcaagttttgcgacttgcgcaacgcgtcaaagccgtttctaatcaccgaggtc
actcactgcgctcgttggtcactcgcatgctcaagtcatcgcatctggttcatctgnnnn
nnnnnnnnnnnnnnnncatctgaaagagcgatcaagctttgggatctgcgcggacataac
tttgccgcaatccagtacacgaatagcttccttggtcaacgaatcggctcggttacagcg
ctcgcattccatccgaactctgcgtaccttgccgctggatctaacgcgggtcacgcgacg
atttatggtcctcatttctga

  All links  
No link information was found.   
DBGET integrated database retrieval system